CRSP6 Antibody - N-terminal region (ARP34192_P050)

Data Sheet
 
Product Number ARP34192_P050
Product Page www.avivasysbio.com/crsp6-antibody-n-terminal-region-arp34192-p050.html
Name CRSP6 Antibody - N-terminal region (ARP34192_P050)
Protein Size (# AA) 651 amino acids
Molecular Weight 73kDa
Subunit 17
NCBI Gene Id 9440
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Mediator complex subunit 17
Description
Alias Symbols SRB4, CRSP6, CRSP77, DRIP80, TRAP80
Peptide Sequence Synthetic peptide located within the following region: AAQILLKGAERLTKSVTENQENKLQRDFNSELLRLRQHWKLRKVGDKILG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Wang,Q., et al., (2002) J. Biol. Chem. 277 (45), 42852-42858
Description of Target The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by CRSP6 is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors.
Protein Interactions UBC; BRCA1; CDK19; CDK8; MED26; POLR2C; ESR2; MED19; FBXW7; EPAS1; TFIP11; MED24; MED21; MED14; MED11; MED28; WDR33; CPSF2; UBD; BCL6; SMARCA4; SUZ12; MED10; CTDP1; SREBF1; MED25; MED15; TRA; MED1; OBFC1; MED18; ZC3H13; MED12; QKI; TRIP4; TADA2A; SUPT7L;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
WBY
SPR
YCHAROS
Datasheets/Manuals Printable datasheet for anti-MED17 (ARP34192_P050) antibody
Blocking Peptide For anti-MED17 (ARP34192_P050) antibody is Catalog # AAP34192 (Previous Catalog # AAPP05507)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CRSP6
Uniprot ID Q9NVC6
Protein Name Mediator of RNA polymerase II transcription subunit 17
Publications

DSIF and NELF interact with Integrator to specify the correct post-transcriptional fate of snRNA genes. Nat Commun. 5, 4263 (2014). 24968874

Hepatic TRAP80 selectively regulates lipogenic activity of liver X receptor. J Clin Invest. 125, 183-93 (2015). 25437875

Sample Type Confirmation

MED17 is supported by BioGPS gene expression data to be expressed in HepG2

Protein Accession # NP_004259
Purification Affinity Purified
Nucleotide Accession # NM_004268
Tested Species Reactivity Human
Gene Symbol MED17
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application IHC, WB, CHIP
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 100%
Image 1
Human Brain
Human Brain
Image 2
HCT116
Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.
Image 3
Human HepG2
WB Suggested Anti-CRSP6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: HepG2 cell lysateMED17 is supported by BioGPS gene expression data to be expressed in HepG2
Image 4
Human Brain
Rabbit Anti-MED17 Antibody
Catalog Number: ARP34192
Paraffin Embedded Tissue: Human neural cell
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 5
Human HepG2 Whole Cell
Host: Rabbit
Target Name: MED17
Sample Tissue: Human HepG2 Whole Cell
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com