COPS2 Antibody - N-terminal region (ARP34189_P050)

Data Sheet
 
Product Number ARP34189_P050
Product Page www.avivasysbio.com/cops2-antibody-n-terminal-region-arp34189-p050.html
Name COPS2 Antibody - N-terminal region (ARP34189_P050)
Protein Size (# AA) 443 amino acids
Molecular Weight 51kDa
Subunit 2
NCBI Gene Id 9318
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis)
Alias Symbols CSN2, SGN2, ALIEN, TRIP15
Peptide Sequence Synthetic peptide located within the following region: MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Moehren,U., et al., (2004) (er) Nucleic Acids Res. 32 (10), 2995-3004
Description of Target COPS2 is an essential component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8/ICSBP. COPS2 is also innvolved in early stage of neuronal differentiation via its interaction with NIF3L1.
Protein Interactions UBC; GPS1; Map3k10; 5830415F09Rik; Taf1b; EP300; Crebbp; cul1; COPS7B; EPB41L1; COPS5; FBXW4; SENP8; vpr; IRF5; COPS4; COPS7A; COPS6; COPS8; COPS3; PMPCA; SEPHS1; EHBP1L1; SLAIN2; GAPVD1; PFKFB2; SEPT2; IRS2; GRK5; DDB2; LRR1; DCAF11; DDA1; RFWD2; DCAF8;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-COPS2 (ARP34189_P050) antibody
Blocking Peptide For anti-COPS2 (ARP34189_P050) antibody is Catalog # AAP34189
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human COPS2
Uniprot ID P61201
Protein Name COP9 signalosome complex subunit 2
Protein Accession # NP_004227
Purification Affinity Purified
Nucleotide Accession # NM_004236
Tested Species Reactivity Human
Gene Symbol COPS2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Application WB, IHC
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 91%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 86%; Zebrafish: 100%
Image 1
Human Fetal liver
WB Suggested Anti-COPS2 Antibody
Titration: 0.5 ug/ml
Positive Control: Fetal Liver
Image 2
Human liver tissue
Rabbit Anti-COPS2 Antibody
Catalog Number: ARP34189_P050
Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue
Observed Staining: Cytoplasm in hepatocytes and endothelial cells in sinusoids
Primary Antibody Concentration: 1:100
Other Working Concentrations: 1:600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com