Product Number |
ARP34189_P050 |
Product Page |
www.avivasysbio.com/cops2-antibody-n-terminal-region-arp34189-p050.html |
Name |
COPS2 Antibody - N-terminal region (ARP34189_P050) |
Protein Size (# AA) |
443 amino acids |
Molecular Weight |
51kDa |
Subunit |
2 |
NCBI Gene Id |
9318 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis) |
Alias Symbols |
CSN2, SGN2, ALIEN, TRIP15 |
Peptide Sequence |
Synthetic peptide located within the following region: MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAA |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Moehren,U., et al., (2004) (er) Nucleic Acids Res. 32 (10), 2995-3004 |
Description of Target |
COPS2 is an essential component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8/ICSBP. COPS2 is also innvolved in early stage of neuronal differentiation via its interaction with NIF3L1. |
Protein Interactions |
UBC; GPS1; Map3k10; 5830415F09Rik; Taf1b; EP300; Crebbp; cul1; COPS7B; EPB41L1; COPS5; FBXW4; SENP8; vpr; IRF5; COPS4; COPS7A; COPS6; COPS8; COPS3; PMPCA; SEPHS1; EHBP1L1; SLAIN2; GAPVD1; PFKFB2; SEPT2; IRS2; GRK5; DDB2; LRR1; DCAF11; DDA1; RFWD2; DCAF8; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-COPS2 (ARP34189_P050) antibody |
Blocking Peptide |
For anti-COPS2 (ARP34189_P050) antibody is Catalog # AAP34189 |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human COPS2 |
Uniprot ID |
P61201 |
Protein Name |
COP9 signalosome complex subunit 2 |
Protein Accession # |
NP_004227 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_004236 |
Tested Species Reactivity |
Human |
Gene Symbol |
COPS2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
Application |
WB, IHC |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Goat: 91%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 86%; Zebrafish: 100% |
Image 1 | Human Fetal liver
| WB Suggested Anti-COPS2 Antibody Titration: 0.5 ug/ml Positive Control: Fetal Liver |
|
Image 2 | Human liver tissue
| Rabbit Anti-COPS2 Antibody Catalog Number: ARP34189_P050 Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue Observed Staining: Cytoplasm in hepatocytes and endothelial cells in sinusoids Primary Antibody Concentration: 1:100 Other Working Concentrations: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec |
|