Product Number |
ARP34181_P050 |
Product Page |
www.avivasysbio.com/csrp3-antibody-middle-region-arp34181-p050.html |
Name |
CSRP3 Antibody - middle region (ARP34181_P050) |
Protein Size (# AA) |
194 amino acids |
Molecular Weight |
21kDa |
NCBI Gene Id |
8048 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Cysteine and glycine-rich protein 3 (cardiac LIM protein) |
Alias Symbols |
CLP, MLP, CRP3, LMO4, CMD1M, CMH12 |
Peptide Sequence |
Synthetic peptide located within the following region: QGAGCLSTDTGEHLGLQFQQSPKPARSVTTSNPSKFTAKFGESEKCPRCG |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Geier,C., et al., (2003) Circulation 107 (10), 1390-1395 |
Description of Target |
The CSRP3 gene encodes a member of the CSRP family of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. The LIM/double zinc-finger motif found in this protein is found in a group of proteins with critical functions in gene regulation, cell growth, and somatic differentiation. Mutations in CSRP3 are thought to cause heritable forms of hypertrophic cardiomyopathy (HCM) and dilated cardiomyopathy (DCM) in humans. |
Protein Interactions |
UBC; HDAC4; LDHD; SPTB; NHLH1; MYF6; MYOG; MYOD1; ACTN1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CSRP3 (ARP34181_P050) antibody |
Blocking Peptide |
For anti-CSRP3 (ARP34181_P050) antibody is Catalog # AAP34181 (Previous Catalog # AAPP05443) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CSRP3 |
Uniprot ID |
P50461 |
Protein Name |
Cysteine and glycine-rich protein 3 |
Publications |
Roberts, M. D., Childs, T. E., Brown, J. D., Davis, J. W. & Booth, F. W. Early depression of Ankrd2 and Csrp3 mRNAs in the polyribosomal and whole tissue fractions in skeletal muscle with decreased voluntary running. J. Appl. Physiol. 112, 1291-9 (2012). 22282489 |
Protein Accession # |
NP_003467 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_003476 |
Tested Species Reactivity |
Human |
Gene Symbol |
CSRP3 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Human HCT116 Whole Cell
| Host: Rabbit Target Name: CSRP3 Sample Tissue: Human HCT116 Whole Cell Antibody Dilution: 1ug/ml |
|
Image 2 | Human Heart
| WB Suggested Anti-CSRP3 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Human heart |
|
Image 3 | Human THP-1 Whole Cell
| Host: Rabbit Target Name: CSRP3 Sample Tissue: Human THP-1 Whole Cell Antibody Dilution: 0.5ug/ml |
|