TRIM26 Antibody - N-terminal region (ARP34178_T100)

Data Sheet
 
Product Number ARP34178_T100
Product Page www.avivasysbio.com/trim26-antibody-n-terminal-region-arp34178-t100.html
Name TRIM26 Antibody - N-terminal region (ARP34178_T100)
Protein Size (# AA) 248 amino acids
Molecular Weight 27kDa
NCBI Gene Id 7726
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Tripartite motif containing 26
Alias Symbols AFP, RNF95, ZNF173
Peptide Sequence Synthetic peptide located within the following region: NHLSTLRRDRDKIQGFQAKGEADILAALKKLQDQRQYIVAEFEQGHQFLR
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target TRIM26 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. Although the function of the protein is unknown, the RING domain suggests that the protein may have DNA-binding activity.
Protein Interactions UBC; AES; THAP1; DDX58; RNF2; SOX2; PNKP; RABEP1; OTUB2; USP36; USP39; USP5; SON; TRIM41; RNF126; PHF7; RNF10; TRIM26; MNAT1; CAND1; CEBPD; SRRM2; SUMO2; UBE2D3; UBE2D2; UBE2D1; MEPCE;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TRIM26 (ARP34178_T100) antibody
Blocking Peptide For anti-TRIM26 (ARP34178_T100) antibody is Catalog # AAP34178 (Previous Catalog # AAPP05440)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human TRIM26
Uniprot ID A2AE48
Protein Name Tripartite motif-containing 26 EMBL CAM25795.1
Sample Type Confirmation

TRIM26 is supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # CAM25547
Purification Protein A purified
Tested Species Reactivity Human
Gene Symbol TRIM26
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 83%; Rabbit: 92%; Rat: 93%
Image 1
Human Jurkat
WB Suggested Anti-TRIM26 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysateTRIM26 is supported by BioGPS gene expression data to be expressed in Jurkat
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com