| Product Number |
ARP34174_T100 |
| Product Page |
www.avivasysbio.com/snapc3-antibody-n-terminal-region-arp34174-t100.html |
| Name |
SNAPC3 Antibody - N-terminal region (ARP34174_T100) |
| Protein Size (# AA) |
411 amino acids |
| Molecular Weight |
45kDa |
| Subunit |
3 |
| NCBI Gene Id |
6619 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Small nuclear RNA activating complex, polypeptide 3, 50kDa |
| Alias Symbols |
SNAP50, PTFbeta |
| Peptide Sequence |
Synthetic peptide located within the following region: CSGVGGRQDPVSGSGGCNFPEYELPELNTRAFHVGAFGELWRGRLRGAGD |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Hirsch,H.A., et al., (2000) Mol. Cell. Biol. 20 (24), 9182-9191 |
| Description of Target |
SNAPC3 is part of the SNAPc complex required for the transcription of both RNA polymerase II and III small-nuclear RNA genes. SNAPC3 binds to the proximal sequence element (PSE), a non-TATA-box basal promoter element common to these 2 types of genes. SNAPC3 recruits TBP and BRF2 to the U6 snRNA TATA box. |
| Protein Interactions |
CEP57L1; HSD17B14; UBC; SNAPC2; UBD; SNAPC1; RB1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SNAPC3 (ARP34174_T100) antibody |
| Blocking Peptide |
For anti-SNAPC3 (ARP34174_T100) antibody is Catalog # AAP34174 (Previous Catalog # AAPP05436) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SNAPC3 |
| Uniprot ID |
Q92966 |
| Protein Name |
snRNA-activating protein complex subunit 3 |
| Protein Accession # |
NP_001034786 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_001039697 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SNAPC3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 86%; Rat: 86% |
| Image 1 | Human Small Intestine
 | WB Suggested Anti-SNAPC3 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Small Intestine |
|
