TPH2 Antibody - N-terminal region (ARP34141_P050)

• Product Number: ARP34141_P050
• Name: TPH2 Antibody - N-terminal region (ARP34141_P050)
• Protein Size (# AA): 490 amino acids
• Molecular Weight: 56kDa
• NCBI Gene Id: 121278
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Tryptophan hydroxylase 2
• Alias Symbols: NTPH, ADHD7
• Peptide Sequence: Synthetic peptide located within the following region: REAATESGKTAVVFSLKNEVGGLVKALRLFQEKRVNMVHIESRKSRRRSS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Walther,D.J., et al., (2003) Science 299 (5603), 76
• Description of Target: Tryptophan hydroxylase (TPH; EC 1.14.16.4) is the rate-limiting enzyme in the synthesis of serotonin (5-hydroxytryptamine, or 5HT). 5HT is causally involved in numerous central nervous activities, and it has several functions in peripheral tissues, including the maintenance of vascular tone and gut motility.
• Protein Interactions: UBC;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-TPH2 (ARP34141_P050) antibody is Catalog # AAP34141 (Previous Catalog # AAPP05403)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TPH2
• Uniprot ID: Q8IWU9
• Protein Name: Tryptophan 5-hydroxylase 2
• Protein Accession #: NP_775489
• Purification: Affinity Purified
• Nucleotide Accession #: NM_173353
• Tested Species Reactivity: Human
• Gene Symbol: TPH2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 83%; Horse: 85%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 100%; Rat: 92%
• Image 1: Human HepG2
  
  WB Suggested Anti-TPH2 Antibody Titration: 0.2-1 ug/ml
  Positive Control: HepG2 cell lysate