C19ORF6 Antibody - middle region (ARP34137_T100)

Data Sheet
 
Product Number ARP34137_T100
Product Page www.avivasysbio.com/c19orf6-antibody-middle-region-arp34137-t100.html
Name C19ORF6 Antibody - middle region (ARP34137_T100)
Protein Size (# AA) 408 amino acids
Molecular Weight 46kDa
NCBI Gene Id 91304
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Chromosome 19 open reading frame 6
Alias Symbols MBRL, ASBABP1, C19orf6, R32184_3, MEMBRALIN
Peptide Sequence Synthetic peptide located within the following region: YDDILMSSVKGLAENEENKGFLRNVVSGEHYRFVSMWMARTSYLAAFAIM
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Andersson,O., et al., (2002) Brain Res. Gene Expr. Patterns 1 (3-4), 205-212
Description of Target Human membralin is unique and does not share significant sequence homology with other human genes, only membralins of other species. The membralin gene contains 11 exons which encode at least two spliced variants in human cancer. The long form of membralin (membralin-1) comprises all 11 exons, encoding a protein of 620-amino acids long and the short form of membralin (membralin-3) contains all exons except for exon 10, encoding a protein of 408 amino acids. Expression of different membralin isoforms depends on tissue type. The long form, membralin-1, is expressed in ovarian and colorectal carcinomas but not in breast or pancreatic carcinomas, which express only the short splice form, membralin-3. Recent studies suggest that membralin is a novel tumor-associated marker in ovarian serous carcinomas
Protein Interactions ADRB2; UBC; TMEM173; ARSE;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TMEM259 (ARP34137_T100) antibody
Blocking Peptide For anti-TMEM259 (ARP34137_T100) antibody is Catalog # AAP34137 (Previous Catalog # AAPP05607)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human C19ORF6
Uniprot ID Q4ZIN3-2
Protein Name Membralin
Sample Type Confirmation

TMEM259 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_219488
Purification Protein A purified
Nucleotide Accession # NM_033420
Tested Species Reactivity Human
Gene Symbol TMEM259
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human kidney
Human kidney
Image 2
Human Jurkat
WB Suggested Anti-C19ORF6 Antibody Titration: 1.0ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysateTMEM259 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com