Product Number |
ARP34137_T100 |
Product Page |
www.avivasysbio.com/c19orf6-antibody-middle-region-arp34137-t100.html |
Name |
C19ORF6 Antibody - middle region (ARP34137_T100) |
Protein Size (# AA) |
408 amino acids |
Molecular Weight |
46kDa |
NCBI Gene Id |
91304 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Chromosome 19 open reading frame 6 |
Alias Symbols |
MBRL, ASBABP1, C19orf6, R32184_3, MEMBRALIN |
Peptide Sequence |
Synthetic peptide located within the following region: YDDILMSSVKGLAENEENKGFLRNVVSGEHYRFVSMWMARTSYLAAFAIM |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Andersson,O., et al., (2002) Brain Res. Gene Expr. Patterns 1 (3-4), 205-212 |
Description of Target |
Human membralin is unique and does not share significant sequence homology with other human genes, only membralins of other species. The membralin gene contains 11 exons which encode at least two spliced variants in human cancer. The long form of membralin (membralin-1) comprises all 11 exons, encoding a protein of 620-amino acids long and the short form of membralin (membralin-3) contains all exons except for exon 10, encoding a protein of 408 amino acids. Expression of different membralin isoforms depends on tissue type. The long form, membralin-1, is expressed in ovarian and colorectal carcinomas but not in breast or pancreatic carcinomas, which express only the short splice form, membralin-3. Recent studies suggest that membralin is a novel tumor-associated marker in ovarian serous carcinomas |
Protein Interactions |
ADRB2; UBC; TMEM173; ARSE; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-TMEM259 (ARP34137_T100) antibody |
Blocking Peptide |
For anti-TMEM259 (ARP34137_T100) antibody is Catalog # AAP34137 (Previous Catalog # AAPP05607) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human C19ORF6 |
Uniprot ID |
Q4ZIN3-2 |
Protein Name |
Membralin |
Sample Type Confirmation |
TMEM259 is strongly supported by BioGPS gene expression data to be expressed in Jurkat |
Protein Accession # |
NP_219488 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_033420 |
Tested Species Reactivity |
Human |
Gene Symbol |
TMEM259 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Zebrafish |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100% |
Image 1 | Human kidney
| Human kidney |
|
Image 2 | Human Jurkat
| WB Suggested Anti-C19ORF6 Antibody Titration: 1.0ug/ml ELISA Titer: 1:62500 Positive Control: Jurkat cell lysateTMEM259 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells |
|