| Product Number |
ARP34130_P050 |
| Product Page |
www.avivasysbio.com/preb-antibody-n-terminal-region-arp34130-p050.html |
| Name |
PREB Antibody - N-terminal region (ARP34130_P050) |
| Protein Size (# AA) |
417 amino acids |
| Molecular Weight |
45kDa |
| NCBI Gene Id |
10113 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Prolactin regulatory element binding |
| Alias Symbols |
SEC12 |
| Peptide Sequence |
Synthetic peptide located within the following region: RVENLQAVQTDFSSDPLQKVVCFNHDNTLLATGGTDGYVRVWKVPSLEKV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Edgar,A.J., et al., (2003) BMC Genomics 4 (1), 18 |
| Description of Target |
PREB encodes a protein that specifically binds to a Pit1-binding element of the prolactin (PRL) promoter. This protein may act as a transcriptional regulator and is thought to be involved in some of the developmental abnormalities observed in patients with partial trisomy 2p. |
| Protein Interactions |
UBC; WWOX; vpu; HSP90AA1; CORO1C; Preb; SMAD1; TGFBR1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PREB (ARP34130_P050) antibody |
| Blocking Peptide |
For anti-PREB (ARP34130_P050) antibody is Catalog # AAP34130 (Previous Catalog # AAPP05339) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human PREB |
| Uniprot ID |
Q9HCU5 |
| Protein Name |
Prolactin regulatory element-binding protein |
| Sample Type Confirmation |
PREB is supported by BioGPS gene expression data to be expressed in Raji |
| Protein Accession # |
NP_037520 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_013388 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PREB |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 83%; Dog: 92%; Guinea Pig: 91%; Horse: 100%; Human: 100%; Mouse: 83%; Pig: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human Raji
 | WB Suggested Anti-PREB Antibody Titration: 0.2-1 ug/ml
Positive Control: Raji cell lysatePREB is supported by BioGPS gene expression data to be expressed in Raji |
|
| Image 2 | Human Heart
 | Rabbit Anti-PREB Antibody
Catalog Number: ARP34130
Paraffin Embedded Tissue: Human cardiac cell
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X |
|
