UBE2N Antibody - middle region (ARP34089_T100)

• Product Number: ARP34089_T100
• Name: UBE2N Antibody - middle region (ARP34089_T100)
• Protein Size (# AA): 152 amino acids
• Molecular Weight: 17kDa
• NCBI Gene Id: 7334
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Ubiquitin-conjugating enzyme E2N
• Alias Symbols: UBC13, UbcH13, HEL-S-71, UbcH-ben, UBCHBEN; UBC13
• Peptide Sequence: Synthetic peptide located within the following region: VDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQW
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Bothos,J., et al., (2003) Oncogene 22 (46), 7101-7107
• Description of Target: UBE2N encodes a member of the E2 ubiquitin-conjugating enzyme family. The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. Studies in mouse suggest that this protein plays a role in DNA postreplication repair.
• Protein Interactions: TRIM33; BFAR; MALT1; STUB1; BCL10; UBE2V2; UBC; TRAF6; ZNRF1; XIAP; SLX8; SLX5; MARCH7; TNF; UBE2N; RNF168; RNF8; PARK2; OTUB1; ARIH1; NEDD4L; MFN2; TRIM72; PELI3; RNF111; RNF11; BAG3; TRAF2; FN1; VCAM1; RNF126; RNF115; NBN; ATP6V1H; VPS33B; ZDHHC5; ACTR2
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-UBE2N (ARP34089_T100) antibody is Catalog # AAP34089 (Previous Catalog # AAPP05238)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human UBE2N
• Uniprot ID: P61088
• Protein Name: Ubiquitin-conjugating enzyme E2 N
• Publications:

  Xu, B. J. et al. Quantitative analysis of the secretome of TGF-beta signaling-deficient mammary fibroblasts. Proteomics 10, 2458-70 (2010). 20405477

• Sample Type Confirmation:

  UBE2N is strongly supported by BioGPS gene expression data to be expressed in HepG2

• Protein Accession #: NP_003339
• Purification: Protein A purified
• Nucleotide Accession #: NM_003348
• Tested Species Reactivity: Human, Mouse
• Gene Symbol: UBE2N
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Yeast, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Yeast: 100%; Zebrafish: 100%
• Image 1: Human HepG2
  
  WB Suggested Anti-UBE2N Antibody Titration: 1.25ug/ml
  Positive Control: HepG2 cell lysateUBE2N is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells
• Image 2: Mouse Spleen
  
  Host: Mouse
  Target Name: UBE2N
  Sample Tissue: Mouse Spleen
  Antibody Dilution: 1ug/ml
• Image 3: Human brainstem
  
  Sample Type:
  Human brain stem cells
  Primary Antibody Dilution:
  1:500
  Secondary Antibody:
  Goat anti-rabbit Alexa-Fluor 594
  Secondary Antibody Dilution:
  1:1000
  Color/Signal Descriptions:
  UBE2N: Red DAPI:Blue
  Gene Name:
  UBE2N
  Submitted by:
  Dr. Yuzhi Chen, University of Arkansas for Medical Science
• Image 4: r-UBE2N
  
  Lanes:
  1: 40ng HIS-UBE2D1 protein
  2: 40ng HIS-UBE2D2 protein
  3: 40ng HIS-UBE2D3 protein
  4: 40ng HIS-UBE2D4 protein
  5: 40ng HIS-UBE2E1 protein
  6: 40ng HIS-UBE2E2 protein
  7: 40ng HIS-UBE2E3 protein
  8: 40ng HIS-UBE2K protein
  9: 40ng HIS-UBE2L3 protein
  10: 40ng HIS-UBE2N protein
  11: 40ng HIS-UBE2V1 protein
  12: 40ng HIS-UBE2V2 protein.
  Primary Antibody Dilution:
  1:500
  Secondary Antibody:
  Anti-rabbit-HRP
  Secondary Antibody Dilution:
  1:50,000
  Gene Name:
  UBE2N
  Submitted by:
  Dr Chris Boutell. MRC-UoG Centre for Virus Research (CVR), UK.