Product Number |
ARP34084_P050 |
Product Page |
www.avivasysbio.com/flj37300-antibody-n-terminal-region-arp34084-p050.html |
Name |
FLJ37300 Antibody - N-terminal region (ARP34084_P050) |
Protein Size (# AA) |
548 amino acids |
Molecular Weight |
62kDa |
NCBI Gene Id |
124602 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Kinesin family member 19 |
Alias Symbols |
KIF19A |
Peptide Sequence |
Synthetic peptide located within the following region: EVSMSYLEIYNEMIRDLLNPSLGYLELREDSKGVIQVAGITEVSTINAKE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Ota,T., et al., (2004) Nat. Genet. 36 (1), 40-45 |
Description of Target |
FLJ37300 is a hypothetical protein found on chromosome 17. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-KIF19 (ARP34084_P050) antibody |
Blocking Peptide |
For anti-KIF19 (ARP34084_P050) antibody is Catalog # AAP34084 (Previous Catalog # AAPP05233) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human FLJ37300 |
Uniprot ID |
Q8N1X8 |
Protein Name |
Kinesin-like protein KIF19 |
Protein Accession # |
NP_694941 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_153209 |
Tested Species Reactivity |
Human |
Gene Symbol |
KIF19 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 86% |
Image 1 | Human Jurkat
| WB Suggested Anti-FLJ37300 Antibody Titration: 0.125ug/ml Positive Control: Jurkat cell lysate |
|
|