FLJ37300 Antibody - N-terminal region (ARP34084_P050)

Data Sheet
 
Product Number ARP34084_P050
Product Page www.avivasysbio.com/flj37300-antibody-n-terminal-region-arp34084-p050.html
Name FLJ37300 Antibody - N-terminal region (ARP34084_P050)
Protein Size (# AA) 548 amino acids
Molecular Weight 62kDa
NCBI Gene Id 124602
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Kinesin family member 19
Alias Symbols KIF19A
Peptide Sequence Synthetic peptide located within the following region: EVSMSYLEIYNEMIRDLLNPSLGYLELREDSKGVIQVAGITEVSTINAKE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ota,T., et al., (2004) Nat. Genet. 36 (1), 40-45
Description of Target FLJ37300 is a hypothetical protein found on chromosome 17.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-KIF19 (ARP34084_P050) antibody
Blocking Peptide For anti-KIF19 (ARP34084_P050) antibody is Catalog # AAP34084 (Previous Catalog # AAPP05233)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human FLJ37300
Uniprot ID Q8N1X8
Protein Name Kinesin-like protein KIF19
Protein Accession # NP_694941
Purification Affinity Purified
Nucleotide Accession # NM_153209
Tested Species Reactivity Human
Gene Symbol KIF19
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 86%
Image 1
Human Jurkat
WB Suggested Anti-FLJ37300 Antibody Titration: 0.125ug/ml
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com