| Product Number |
ARP34051_T100 |
| Product Page |
www.avivasysbio.com/rgs13-antibody-middle-region-arp34051-t100.html |
| Name |
RGS13 Antibody - middle region (ARP34051_T100) |
| Protein Size (# AA) |
159 amino acids |
| Molecular Weight |
19kDa |
| NCBI Gene Id |
6003 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Regulator of G-protein signaling 13 |
| Peptide Sequence |
Synthetic peptide located within the following region: WSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQK |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Islam,T.C., (2003) Leukemia 17(9), 1880-90 |
| Description of Target |
RGS13 encodes a protein which is a member of the regulator of G protein signaling (RGS) family. RGS proteins accelerate GTPase activity of G protein alpha-subunits, thereby driving G protein into their inactive GDP-bound form, thus negatively regulating G protein signaling. RGS proteins have been implicated in the fine tuning of a variety of cellular events in response to G protein-coupled receptor activation. |
| Protein Interactions |
GNAI2; GNA11; UBC; PRKACA; CREB1; GNAQ; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-RGS13 (ARP34051_T100) antibody |
| Blocking Peptide |
For anti-RGS13 (ARP34051_T100) antibody is Catalog # AAPY00120 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human RGS13 |
| Uniprot ID |
O14921 |
| Protein Name |
Regulator of G-protein signaling 13 |
| Sample Type Confirmation |
RGS13 is supported by BioGPS gene expression data to be expressed in Daudi |
| Protein Accession # |
NP_002918 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_002927 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
RGS13 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Horse: 92%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100% |
| Image 1 | Human kidney
 | Human kidney |
|
| Image 2 | Human Daudi
 | WB Suggested Anti-RGS13 Antibody Titration: 1.25ug/ml
Positive Control: Daudi cell lysateRGS13 is supported by BioGPS gene expression data to be expressed in Daudi |
|
