| Product Number |
ARP34043_P050 |
| Product Page |
www.avivasysbio.com/rgs6-antibody-c-terminal-region-arp34043-p050.html |
| Name |
RGS6 Antibody - C-terminal region (ARP34043_P050) |
| Protein Size (# AA) |
472 amino acids |
| Molecular Weight |
54kDa |
| NCBI Gene Id |
9628 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Regulator of G-protein signaling 6 |
| Alias Symbols |
GAP, S914, HA117 |
| Peptide Sequence |
Synthetic peptide located within the following region: SAINLDSHSYEITSQNVKDGGRYTFEDAQEHIYKLMKSDSYARFLRSNAY |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Liu,Z. et al., (2004) J. Biol. Chem. 279 (14), 14120-14128 |
| Description of Target |
Members of the RGS (regulator of G protein signaling) family have been shown to modulate the functioning of G proteins by activating the intrinsic GTPase activity of the alpha (guanine nucleotide-binding) subunits. |
| Protein Interactions |
HSP90AA1; GNB4; GNB5; GNB3; GNB2; GNB1; STMN2; DMAP1; DNMT1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-RGS6 (ARP34043_P050) antibody |
| Blocking Peptide |
For anti-RGS6 (ARP34043_P050) antibody is Catalog # AAP34043 (Previous Catalog # AAPP05123) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human RGS6 |
| Uniprot ID |
P49758-4 |
| Protein Name |
Regulator of G-protein signaling 6 |
| Protein Accession # |
NP_004287 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_004296 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
RGS6 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB, IHC |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 86% |
| Image 1 | Human kidney
 | Human kidney |
|
| Image 2 | Human Pineal Tissue
 | RGS6 antibody - C-terminal region (ARP34043_P050)
Catalog Number: ARP34043_P050
Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue
Observed Staining: Cytoplasm and Membrane of Human Pineal Tissue
Primary Antibody Concentration: 1:100
Other Working Concentrations: 1/600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec |
|
| Image 3 | Human Jurkat
 | WB Suggested Anti-RGS6 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate |
|
