| Product Number |
ARP34040_T100 |
| Product Page |
www.avivasysbio.com/rgs16-antibody-c-terminal-region-arp34040-t100.html |
| Name |
RGS16 Antibody - C-terminal region (ARP34040_T100) |
| Protein Size (# AA) |
202 amino acids |
| Molecular Weight |
23kDa |
| NCBI Gene Id |
6004 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Regulator of G-protein signaling 16 |
| Alias Symbols |
RGS-R, A28-RGS14, A28-RGS14P |
| Peptide Sequence |
Synthetic peptide located within the following region: DAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASAASATLSSCSLDEPSHT |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Johnson,E.N., et al., (2003) Nat. Cell Biol. 5 (12), 1095-1103 |
| Description of Target |
RGS16 belongs to the 'regulator of G protein signaling' family. It inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits. It also may play a role in regulating the kinetics of signaling in the phototransduction cascade. |
| Protein Interactions |
SRC; LYN; CSK; CREB3L2; ST14; GDE1; GNAT1; GNA13; GNAQ; GNAI3; GNAI2; GNAO1; GNAI1; EGFR; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-RGS16 (ARP34040_T100) antibody |
| Blocking Peptide |
For anti-RGS16 (ARP34040_T100) antibody is Catalog # AAP34040 (Previous Catalog # AAPP05120) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human RGS16 |
| Uniprot ID |
Q5VYN9 |
| Protein Name |
Regulator of G-protein signaling 16 |
| Publications |
Timmusk, S. et al. Regulator of G protein signalling 16 is a target for a porcine circovirus type 2 protein. J. Gen. Virol. 90, 2425-36 (2009). 19570954 |
| Protein Accession # |
NP_002919 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_002928 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
RGS16 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig |
| Application |
WB, IF |
| Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-RGS16 Antibody Titration: 1.0ug/ml
Positive Control: Jurkat cell lysate |
|
| Image 2 | Human Liver, HepG2 Cell Lysate
 | Host: Rabbit
Target: RGS16
Positive control (+): Human Liver (LI)
Negative control (-): HepG2 Cell Lysate (HG)
Antibody concentration: 0.5ug/ml |
|
