KIF23 Antibody - N-terminal region (ARP33963_T100)

Data Sheet
 
Product Number ARP33963_T100
Product Page www.avivasysbio.com/kif23-antibody-n-terminal-region-arp33963-t100.html
Name KIF23 Antibody - N-terminal region (ARP33963_T100)
Protein Size (# AA) 856 amino acids
Molecular Weight 98kDa
NCBI Gene Id 9493
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Kinesin family member 23
Alias Symbols CHO1, KNSL5, MKLP1, MKLP-1
Peptide Sequence Synthetic peptide located within the following region: MKSARAKTPRKPTVKKGSQTNLKDPVGVYCRVRPLGFPDQECCIEVINNT
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Kimura,K., et al., (2006) Genome Res. 16 (1), 55-65
Description of Target KIF23 is a member of kinesin-like protein family. This family includes microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. This protein has been shown to cross-bridge antiparallel microtubules and drive microtubule movement in vitro. Alternate splicing of this gene results in two transcript variants encoding two different isoforms.
Protein Interactions UBC; YWHAQ; YWHAE; RACGAP1; XRCC6; IKBKG; SIRT7; SH3KBP1; SUMO2; Kif23; Dctn2; Shcbp1; Cd2ap; YWHAZ; YWHAH; YWHAG; YWHAB; STK11; CENPA; PRC1; FYCO1; PLK1; ARF3; ACTA1; BIRC6; USP8; PKLR; SFN;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-KIF23 (ARP33963_T100) antibody
Blocking Peptide For anti-KIF23 (ARP33963_T100) antibody is Catalog # AAP33963 (Previous Catalog # AAPP05038)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human KIF23
Uniprot ID Q02241
Protein Name Kinesin-like protein KIF23
Protein Accession # NP_004847
Purification Protein A purified
Nucleotide Accession # NM_004856
Tested Species Reactivity Human, Mouse
Gene Symbol KIF23
Predicted Species Reactivity Human, Mouse, Rat, Cow, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 85%; Horse: 85%; Human: 100%; Mouse: 85%; Rabbit: 92%; Rat: 85%
Image 1
Human Jurkat
WB Suggested Anti-KIF23 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate
Image 2
Mouse Testis
Host: Mouse
Target Name: KIF23
Sample Tissue: Mouse Testis
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com