| Product Number |
ARP33945_P050 |
| Product Page |
www.avivasysbio.com/kif12-antibody-n-terminal-region-arp33945-p050.html |
| Name |
KIF12 Antibody - N-terminal region (ARP33945_P050) |
| Protein Size (# AA) |
513 amino acids |
| Molecular Weight |
56kDa |
| NCBI Gene Id |
113220 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Kinesin family member 12 |
| Alias Symbols |
RP11-56P10.3 |
| Peptide Sequence |
Synthetic peptide located within the following region: SLGSPRPLPVRWNKTRGFYVEQLRVVEFGSLEALMELLQTGLSRRRNSAH |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Katoh,M. (2005) Oncol. Rep. 13 (2), 367-370 |
| Description of Target |
KIF12 is a member of the kinesin superfamily of microtubule-associated molecular motors that play important roles in intracellular transport and cell division.KIF12 is a member of the kinesin superfamily of microtubule-associated molecular motors (see MIM 148760) that play important roles in intracellular transport and cell division (Nakagawa et al., 1997 [PubMed 9275178]).[supplied by OMIM]. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-KIF12 (ARP33945_P050) antibody |
| Blocking Peptide |
For anti-KIF12 (ARP33945_P050) antibody is Catalog # AAP33945 (Previous Catalog # AAPS07404) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human KIF12 |
| Uniprot ID |
B1ALC3 |
| Protein Name |
Kinesin family member 12 EMBL CAI15900.1 |
| Protein Accession # |
NP_612433 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_138424 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
KIF12 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 85%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human 721_B
 | WB Suggested Anti-KIF12 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 721_B cell lysate |
|
|
