| Product Number |
ARP33925_T100 |
| Product Page |
www.avivasysbio.com/kif25-antibody-c-terminal-region-arp33925-t100.html |
| Name |
KIF25 Antibody - C-terminal region (ARP33925_T100) |
| Protein Size (# AA) |
384 amino acids |
| Molecular Weight |
41kDa |
| NCBI Gene Id |
3834 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Kinesin family member 25 |
| Alias Symbols |
KNSL3 |
| Peptide Sequence |
Synthetic peptide located within the following region: VLGALLEHRGHAPYRNSRLTHLLQDCLGGDAKLLVILCISPSQRHLAQTL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Miki,H., et al., (2001) Proc. Natl. Acad. Sci. U.S.A. 98 (13), 7004-7011 |
| Description of Target |
The protein encoded by the KIF25 gene is a member of the kinesin-like protein family. Protein family members are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. However, the particular function of this gene product has not yet been determined. Two alternatively spliced transcript variants which encode products have been described. Other splice variants have been found that lack exon 2 and the initiation codon for translation. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-KIF25 (ARP33925_T100) antibody |
| Blocking Peptide |
For anti-KIF25 (ARP33925_T100) antibody is Catalog # AAP33925 (Previous Catalog # AAPP04996) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human KIF25 |
| Uniprot ID |
Q9UIL4 |
| Protein Name |
Kinesin-like protein KIF25 |
| Protein Accession # |
NP_085118 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_030615 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
KIF25 |
| Predicted Species Reactivity |
Human, Rat, Dog, Guinea Pig, Horse |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 79%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Rat: 79% |
| Image 1 | Human kidney
 | Human kidney |
| | Image 2 | Human HepG2
 | WB Suggested Anti-KIF25 Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate |
|
|
