KIF22 Antibody - C-terminal region (ARP33920_T100)

• Product Number: ARP33920_T100
• Name: KIF22 Antibody - C-terminal region (ARP33920_T100)
• Protein Size (# AA): 665 amino acids
• Molecular Weight: 73kDa
• NCBI Gene Id: 3835
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Kinesin family member 22
• Alias Symbols: KID, OBP, KNSL4, OBP-1, OBP-2, SEMDJL2, A-328A3.2
• Peptide Sequence: Synthetic peptide located within the following region: LASQGSQGAPLLSTPKRERMVLMKTVEEKDLEIERLKTKQKELEAKMLAQ
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Maruyama,K. (2005) Mol. Biol. Cell 16 (11), 5455-5463
• Description of Target: KIF22 a member of kinesin-like protein family. This family of proteins are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. The C-terminal half of this protein has been shown to bind DNA. Studies with the Xenopus homolog suggests its essential role in metaphase chromosome alignment and maintenance.The protein encoded by this gene is a member of kinesin-like protein family. This family of proteins are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. The C-terminal half of this protein has been shown to bind DNA. Studies with the Xenopus homolog suggests its essential role in metaphase chromosome alignment and maintenance.
• Protein Interactions: UBC; ATXN1; CHFR; SUMO2; SVIL; tat; SIAH1; GDF9; IMMT; PJA1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-KIF22 (ARP33920_T100) antibody is Catalog # AAP33920 (Previous Catalog # AAPP23737)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human KIF22
• Uniprot ID: Q14807
• Protein Name: Kinesin-like protein KIF22
• Sample Type Confirmation:

  KIF22 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

• Protein Accession #: NP_015556
• Purification: Protein A purified
• Nucleotide Accession #: NM_007317
• Tested Species Reactivity: Human
• Gene Symbol: KIF22
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Yeast
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 86%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 90%; Pig: 93%; Rat: 93%; Yeast: 83%
• Image 1: Human Jurkat
  
  WB Suggested Anti-KIF22 Antibody Titration: 2.5ug/ml
  Positive Control: Jurkat cell lysateKIF22 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells