KIF1C Antibody - C-terminal region (ARP33913_T100)

Data Sheet
 
Product Number ARP33913_T100
Product Page www.avivasysbio.com/kif1c-antibody-c-terminal-region-arp33913-t100.html
Name KIF1C Antibody - C-terminal region (ARP33913_T100)
Protein Size (# AA) 1103 amino acids
Molecular Weight 123kDa
NCBI Gene Id 10749
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Kinesin family member 1C
Alias Symbols SAX2, LTXS1, SATX2, SPAX2, SPG58
Peptide Sequence Synthetic peptide located within the following region: GGGRSRGAGSAQPEPQHFQPKKHNSYPQPPQPYPAQRPPGPRYPPYTTPP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Dorner,C., et al., (1998) J. Biol. Chem. 273 (32), 20267-20275
Description of Target KIF1C represents a member of the Unc104 subfamily of kinesin-like proteins that are involved in the transport of mitochondria or synaptic vesicles in axons. KIF1C consists of an amino-terminal motor domain followed by a U104 domain and probably binds to target membranes through carboxyl-terminal sequences.
Protein Interactions UBC; STAU1; YWHAB; YWHAE; Ccdc64; YWHAQ; LAMC3; YWHAZ; Kif1c; YWHAG; PTPN21; CSNK2A2; CSNK2A1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-KIF1C (ARP33913_T100) antibody
Blocking Peptide For anti-KIF1C (ARP33913_T100) antibody is Catalog # AAP33913 (Previous Catalog # AAPP04984)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human KIF1C
Uniprot ID O43896
Protein Name Kinesin-like protein KIF1C
Protein Accession # NP_006603
Purification Protein A purified
Nucleotide Accession # NM_006612
Tested Species Reactivity Human
Gene Symbol KIF1C
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 77%; Horse: 92%; Human: 100%; Mouse: 77%; Pig: 100%; Rabbit: 100%; Rat: 85%
Image 1
Human HeLa
WB Suggested Anti-KIF1C Antibody Titration: 2.5ug/ml
Positive Control: Hela cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com