PHYHIP Antibody - N-terminal region (ARP33878_T100)

Data Sheet
 
Product Number ARP33878_T100
Product Page www.avivasysbio.com/phyhip-antibody-n-terminal-region-arp33878-t100.html
Name PHYHIP Antibody - N-terminal region (ARP33878_T100)
Protein Size (# AA) 330 amino acids
Molecular Weight 38kDa
NCBI Gene Id 9796
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Phytanoyl-CoA 2-hydroxylase interacting protein
Alias Symbols PAHX-AP, PAHXAP1, DYRK1AP3
Peptide Sequence Synthetic peptide located within the following region: VSGWSETVEFCTGDYAKEHLAQLQEKAEQIAGRMLRFSVFYRNHHKEYFQ
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Bescond,M. (2005) Int. J. Biochem. Cell Biol. 37 (4), 775-783
Description of Target PHYHIP interacts with PHYH suggests a role in the development of the central system.
Protein Interactions COPS6; PHYHIP; ZZEF1; METTL18; FAM131A; WDR89; PNPLA2; HDAC11; NFE2; DYRK1A; MED8; MAGED4B; NDRG1; C14orf1; PRMT5; BAI1; PPIE; NDUFV3; SUPT5H; PHYH; S100A13; SMARCC2; TTR; HNRNPA1; EEF1A1; Supt5;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PHYHIP (ARP33878_T100) antibody
Blocking Peptide For anti-PHYHIP (ARP33878_T100) antibody is Catalog # AAP33878 (Previous Catalog # AAPP04949)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PHYHIP
Uniprot ID Q92561
Protein Name Phytanoyl-CoA hydroxylase-interacting protein
Protein Accession # NP_055574
Purification Protein A purified
Nucleotide Accession # NM_014759
Tested Species Reactivity Human
Gene Symbol PHYHIP
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 90%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Transfected 293T
WB Suggested Anti-PHYHIP Antibody Titration: 1.25ug/ml
Positive Control: Transfected 293T
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com