KIF5A Antibody - middle region (ARP33868_P050)

Data Sheet
 
Product Number ARP33868_P050
Product Page www.avivasysbio.com/kif5a-antibody-middle-region-arp33868-p050.html
Name KIF5A Antibody - middle region (ARP33868_P050)
Protein Size (# AA) 1032 amino acids
Molecular Weight 117 kDa
NCBI Gene Id 3798
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Kinesin family member 5A
Alias Symbols NKHC, ALS25, MY050, NEIMY, SPG10, D12S1889
Peptide Sequence Synthetic peptide located within the following region: LEESYDSLSDELAKLQAQETVHEVALKDKEPDTQDADEVKKALELQMESH
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Reid,E., et al., (2002) Am. J. Hum. Genet. 71 (5), 1189-1194
Description of Target KIF5A is a member of the kinesin family of proteins. Members of this family are part of a multisubunit complex that functions as a microtubule motor in intracellular organelle transport. Mutations in this gene cause autosomal dominant spastic paraplegia 10.
Protein Interactions UBC; KIF11; KLC1; KLC4; KLC2; EXOC1; KCNE3; TK1; SMN1; PIN1; STAU1; RAPGEF2; MAP4K4; TP53BP2; KIF5A; DTNB; NCOA2; KIF5B; ITSN1; KLC3; YAP1; TSG101;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
WBY
SPR
YCHAROS
Datasheets/Manuals Printable datasheet for anti-KIF5A (ARP33868_P050) antibody
Blocking Peptide For anti-KIF5A (ARP33868_P050) antibody is Catalog # AAP33868 (Previous Catalog # AAPP04939)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human KIF5A
Uniprot ID Q12840
Protein Name Kinesin heavy chain isoform 5A
Protein Accession # NP_004975
Purification Affinity Purified
Nucleotide Accession # NM_004984
Tested Species Reactivity Human
Gene Symbol KIF5A
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 79%; Dog: 100%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 100%; Rat: 93%
Image 1
Human Lung
Rabbit Anti-KIF5A antibody
Catalog Number: ARP33868
Paraffin Embedded Tissue: Human Lung cell Cellular Data: bronchiole epithelium of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 2
Human brain
WB Suggested Anti-KIF5A Antibody Titration: 0.2-1 ug/ml
Positive Control: Human brain
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com