| Product Number |
ARP33864_P050 |
| Product Page |
www.avivasysbio.com/ctrl-antibody-n-terminal-region-arp33864-p050.html |
| Name |
CTRL Antibody - N-terminal region (ARP33864_P050) |
| Protein Size (# AA) |
264 amino acids |
| Molecular Weight |
28kDa |
| NCBI Gene Id |
1506 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Chymotrypsin-like |
| Alias Symbols |
CTRL1 |
| Peptide Sequence |
Synthetic peptide located within the following region: SQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Lee,M., (2002) Arterioscler. Thromb. Vasc. Biol. 22 (9), 1475-1481 |
| Description of Target |
The function remains unknown. |
| Protein Interactions |
SERPINA3; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CTRL (ARP33864_P050) antibody |
| Blocking Peptide |
For anti-CTRL (ARP33864_P050) antibody is Catalog # AAP33864 (Previous Catalog # AAPP04935) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human CTRL |
| Uniprot ID |
P40313 |
| Protein Name |
Chymotrypsin-like protease CTRL-1 |
| Protein Accession # |
NP_001898 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001907 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CTRL |
| Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 92%; Human: 100%; Mouse: 83%; Pig: 77%; Rat: 85% |
| Image 1 | Transfected 293T
 | WB Suggested Anti-CTRL Antibody Titration: 0.2-1 ug/ml
Positive Control: Transfected 293T |
|
|
