Product Number |
ARP33859_P050 |
Product Page |
www.avivasysbio.com/cpa1-antibody-n-terminal-region-arp33859-p050.html |
Name |
CPA1 Antibody - N-terminal region (ARP33859_P050) |
Protein Size (# AA) |
419 amino acids |
Molecular Weight |
47kDa |
NCBI Gene Id |
1357 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Carboxypeptidase A1 (pancreatic) |
Alias Symbols |
CPA |
Peptide Sequence |
Synthetic peptide located within the following region: QVLRISVADEAQVQKVKELEDLEHLQLDFWRGPAHPGSPIDVRVPFPSIQ |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Scherer,S.W., et al., (2003) Science 300 (5620), 767-772 |
Description of Target |
Three different forms of human pancreatic procarboxypeptidase A have been isolated. The A1 and A2 forms are monomeric proteins with different biochemical properties. Carboxypeptidase A1 is a monomeric pancreatic exopeptidase. It is involved in zymogen inhibition. |
Protein Interactions |
ARRB1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CPA1 (ARP33859_P050) antibody |
Blocking Peptide |
For anti-CPA1 (ARP33859_P050) antibody is Catalog # AAP33859 (Previous Catalog # AAPP04930) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human CPA1 |
Uniprot ID |
P15085 |
Protein Name |
Carboxypeptidase A1 |
Protein Accession # |
NP_001859 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001868 |
Tested Species Reactivity |
Human |
Gene Symbol |
CPA1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 83%; Dog: 86%; Horse: 100%; Human: 100%; Mouse: 79%; Pig: 93%; Rabbit: 79%; Rat: 93% |
Image 1 | Human HepG2
| WB Suggested Anti-CPA1 Antibody Titration: 0.2-1 ug/ml Positive Control: HepG2 cell lysate |
|
|