CPA1 Antibody - N-terminal region (ARP33859_P050)

• Product Number: ARP33859_P050
• Name: CPA1 Antibody - N-terminal region (ARP33859_P050)
• Protein Size (# AA): 419 amino acids
• Molecular Weight: 47kDa
• NCBI Gene Id: 1357
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Carboxypeptidase A1 (pancreatic)
• Alias Symbols: CPA
• Peptide Sequence: Synthetic peptide located within the following region: QVLRISVADEAQVQKVKELEDLEHLQLDFWRGPAHPGSPIDVRVPFPSIQ
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Scherer,S.W., et al., (2003) Science 300 (5620), 767-772
• Description of Target: Three different forms of human pancreatic procarboxypeptidase A have been isolated. The A1 and A2 forms are monomeric proteins with different biochemical properties. Carboxypeptidase A1 is a monomeric pancreatic exopeptidase. It is involved in zymogen inhibition.
• Protein Interactions: ARRB1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CPA1 (ARP33859_P050) antibody is Catalog # AAP33859 (Previous Catalog # AAPP04930)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CPA1
• Uniprot ID: P15085
• Protein Name: Carboxypeptidase A1
• Protein Accession #: NP_001859
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001868
• Tested Species Reactivity: Human
• Gene Symbol: CPA1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 83%; Dog: 86%; Horse: 100%; Human: 100%; Mouse: 79%; Pig: 93%; Rabbit: 79%; Rat: 93%
• Image 1: Human HepG2
  
  WB Suggested Anti-CPA1 Antibody Titration: 0.2-1 ug/ml
  Positive Control: HepG2 cell lysate