| Product Number |
ARP33854_P050 |
| Product Page |
www.avivasysbio.com/arhgdig-antibody-n-terminal-region-arp33854-p050.html |
| Name |
ARHGDIG Antibody - N-terminal region (ARP33854_P050) |
| Protein Size (# AA) |
225 amino acids |
| Molecular Weight |
25kDa |
| NCBI Gene Id |
398 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Rho GDP dissociation inhibitor (GDI) gamma |
| Alias Symbols |
RHOGDI-3 |
| Peptide Sequence |
Synthetic peptide located within the following region: DEAVPEYRAPGRKSLLEIRQLDPDDRSLAKYKRVLLGPLPPAVDPSLPN |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Adra,C.N., et al., (1998) Genomics 53 (1), 104-109 |
| Description of Target |
ARHGDIG is highly expressed in the entire brain, with regional variations. The mRNA is also present at high levels in kidney and pancreas and at moderate levels in spinal cord, stomach, and pituitary gland. ARHGDIG is mapped to chromosome band 16p13.3 which is rich in deletion mutants of genes involved in several human diseases, notably polycystic kidney disease, alpha-thalassemia, tuberous sclerosis, mental retardation, and cancer. |
| Protein Interactions |
CEP170P1; KXD1; RAC1; RHOH; RHOG; RHOA; RHOB; CDC42; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ARHGDIG (ARP33854_P050) antibody |
| Blocking Peptide |
For anti-ARHGDIG (ARP33854_P050) antibody is Catalog # AAP33854 (Previous Catalog # AAPP04925) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ARHGDIG |
| Uniprot ID |
Q99819 |
| Protein Name |
Rho GDP-dissociation inhibitor 3 |
| Protein Accession # |
NP_001167 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001176 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ARHGDIG |
| Predicted Species Reactivity |
Human, Horse |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Horse: 77%; Human: 100% |
| Image 1 | Human Daudi
 | WB Suggested Anti-ARHGDIG Antibody Titration: 0.2-1 ug/ml
Positive Control: Daudi cell lysate |
|
|
