| Product Number |
ARP33852_T100 |
| Product Page |
www.avivasysbio.com/pnlip-antibody-c-terminal-region-arp33852-t100.html |
| Name |
PNLIP Antibody - C-terminal region (ARP33852_T100) |
| Protein Size (# AA) |
465 amino acids |
| Molecular Weight |
51kDa |
| NCBI Gene Id |
5406 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Pancreatic lipase |
| Alias Symbols |
PL, PTL, PNLIPD |
| Peptide Sequence |
Synthetic peptide located within the following region: GHYADRYPGKTNDVGQKFYLDTGDASNFARWRYKVSVTLSGKKVTGHILV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Ramos,P., et al., (2003) Biochemistry 42 (43), 12488-12496 |
| Description of Target |
PNLIP is a member of the lipase gene family. PNLIP is a carboxyl esterase that hydrolyzes insoluble, emulsified triglycerides, and is essential for the efficient digestion of dietary fats. It is expressed specifically in the pancreas. |
| Protein Interactions |
LMF1; YWHAE; CLPS; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PNLIP (ARP33852_T100) antibody |
| Blocking Peptide |
For anti-PNLIP (ARP33852_T100) antibody is Catalog # AAP33852 (Previous Catalog # AAPP04923) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human PNLIP |
| Uniprot ID |
P16233 |
| Protein Name |
Pancreatic triacylglycerol lipase |
| Publications |
Itoh, M. et al. Partial loss of pancreas endocrine and exocrine cells of human ARX-null mutation: consideration of pancreas differentiation. Differentiation. 80, 118-22 20538404 |
| Protein Accession # |
NP_000927 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_000936 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PNLIP |
| Predicted Species Reactivity |
Human, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100%; Rabbit: 82% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-PNLIP Antibody Titration: 1.0ug/ml
Positive Control: Jurkat cell lysate |
| | Image 2 | Human kidney
 | Human kidney |
|
|
