PNLIP Antibody - C-terminal region (ARP33851_T100)

• Product Number: ARP33851_T100
• Name: PNLIP Antibody - C-terminal region (ARP33851_T100)
• Protein Size (# AA): 465 amino acids
• Molecular Weight: 51kDa
• NCBI Gene Id: 5406
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Pancreatic lipase
• Alias Symbols: PL, PTL, PNLIPD
• Peptide Sequence: Synthetic peptide located within the following region: SGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQ
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Freie,A.B., et al., (2006) J. Biol. Chem. 281 (12), 7793-7800
• Description of Target: PNLIP is a member of the lipase gene family. It encodes a carboxyl esterase that hydrolyzes insoluble, emulsified triglycerides, and is essential for the efficient digestion of dietary fats. This gene is expressed specifically in the pancreas.
• Protein Interactions: LMF1; YWHAE; CLPS;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-PNLIP (ARP33851_T100) antibody is Catalog # AAP33851 (Previous Catalog # AAPP04922)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PNLIP
• Uniprot ID: P16233
• Protein Name: Pancreatic triacylglycerol lipase
• Protein Accession #: NP_000927
• Purification: Protein A purified
• Nucleotide Accession #: NM_000936
• Tested Species Reactivity: Human
• Gene Symbol: PNLIP
• Predicted Species Reactivity: Human, Cow, Dog, Horse, Pig
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 86%; Horse: 85%; Human: 100%; Pig: 86%
• Image 1: Human Jurkat
  
  WB Suggested Anti-PNLIP Antibody Titration: 1.25ug/ml
  Positive Control: Jurkat cell lysate