CCK Antibody - middle region (ARP33849_P050)

• Product Number: ARP33849_P050
• Name: CCK Antibody - middle region (ARP33849_P050)
• Protein Size (# AA): 115 amino acids
• Molecular Weight: 13 kDa
• NCBI Gene Id: 885
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Cholecystokinin
• Alias Symbols: MGC117187
• Peptide Sequence: Synthetic peptide located within the following region: IQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Lei,Z.M., (2008) HBPD INT 7 (1), 65-69
• Description of Target: Cholecystokinin (CCK) is a brain/gut peptide. In the gut, it induces the release of pancreatic enzymes and the contraction of the gallbladder. In the brain, its physiologic role is unclear. The cholecystokinin pro-hormone is processed by endo- and exo-proteolytic cleavages.Cholecystokinin is a brain/gut peptide. In the gut, it induces the release of pancreatic enzymes and the contraction of the gallbladder. In the brain, its physiologic role is unclear. The cholecystokinin pro-hormone is processed by endo- and exo-proteolytic cleavages. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Protein Interactions: UBC; CCKBR; CCKAR; CPE; ENPEP; MEP1B; MEP1A;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation: Relative Expression (Western Blot)
  
• Blocking Peptide: For anti-CCK (ARP33849_P050) antibody is Catalog # AAP33849 (Previous Catalog # AAPP04920)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CCK
• Uniprot ID: P06307
• Protein Name: Cholecystokinin
• Publications:

  Talchai, C., Xuan, S., Kitamura, T., DePinho, R. A. & Accili, D. Generation of functional insulin-producing cells in the gut by Foxo1 ablation. Nat. Genet. 44, 406-12, S1 (2012). 22406641

• Protein Accession #: NP_000720
• Purification: Affinity Purified
• Nucleotide Accession #: NM_000729
• Tested Species Reactivity: Human
• Gene Symbol: CCK
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 93%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 92%; Pig: 86%; Rabbit: 86%; Rat: 92%
• Image 1: Human Brain
  
  WB Suggested Anti-CCK Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: Human brain
• Image 2: Human brain, 293T
  
  Host: Rabbit
  Target: CCK
  Positive control (+): Human brain (BR)
  Negative control (-): 293T (2T)
  Antibody concentration: 1ug/ml
• Image 3: Western Blot
  
  25 ug of the indicated Human whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.