| Product Number |
ARP33827_T100 |
| Product Page |
www.avivasysbio.com/fabp7-antibody-n-terminal-region-arp33827-t100.html |
| Name |
FABP7 Antibody - N-terminal region (ARP33827_T100) |
| Protein Size (# AA) |
132 amino acids |
| Molecular Weight |
15 kDa |
| NCBI Gene Id |
2173 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Fatty acid binding protein 7, brain |
| Alias Symbols |
MRG, BLBP, FABPB, B-FABP |
| Peptide Sequence |
Synthetic peptide located within the following region: NFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISF |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Wang,M., et al., (2003) J. Biol. Chem. 278 (47), 47319-47325 |
| Description of Target |
The protein encoded by FABP7 is a brain fatty acid binding protein. Fatty acid binding proteins (FABPs) are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs are thought to play roles in fatty acid uptake, transport, and metabolism. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Enhanced Validation |
|
| Datasheets/Manuals |
Printable datasheet for anti-FABP7 (ARP33827_T100) antibody |
| Blocking Peptide |
For anti-FABP7 (ARP33827_T100) antibody is Catalog # AAP33827 (Previous Catalog # AAPP04893) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human FABP7 |
| Uniprot ID |
O15540 |
| Protein Name |
Fatty acid-binding protein, brain |
| Publications |
Sun, Y. et al. A gel-based proteomic method reveals several protein pathway abnormalities in fetal Down syndrome brain. J. Proteomics 74, 547-57 (2011). 21262400 |
| Protein Accession # |
NP_001437 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_001446 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
FABP7 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85% |
| Image 1 | Human Brain
 | WB Suggested Anti-FABP7 Antibody Titration: 1.25ug/ml
Positive Control: Human brain |
|
|
