Product Number |
ARP33815_P050 |
Product Page |
www.avivasysbio.com/ahsg-antibody-n-terminal-region-arp33815-p050.html |
Name |
AHSG Antibody - N-terminal region (ARP33815_P050) |
Protein Size (# AA) |
367 amino acids |
Molecular Weight |
39kDa |
NCBI Gene Id |
197 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Alpha-2-HS-glycoprotein |
Alias Symbols |
AHS, A2HS, HSGA, APMR1, FETUA |
Peptide Sequence |
Synthetic peptide located within the following region: AQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Ix,J.H., et al., (2006) Circulation 113 (14), 1760-1767 |
Description of Target |
Alpha2-HS glycoprotein (AHSG), a glycoprotein present in the serum, is synthesized by hepatocytes. The AHSG molecule consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue. However, its exact significance is still obscure.Alpha2-HS glycoprotein (AHSG), a glycoprotein present in the serum, is synthesized by hepatocytes. The AHSG molecule consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue. The protein is commonly present in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix, and it has therefore been postulated that it participates in the development of the tissues. However, its exact significance is still obscure.Alpha2-HS glycoprotein (AHSG), a glycoprotein present in the serum, is synthesized by hepatocytes. The AHSG molecule consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue. The protein is commonly present in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix, and it has therefore been postulated that it participates in the development of the tissues. However, its exact significance is still obscure. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Protein Interactions |
SUMO1; UBC; NEDD8; ATF2; ALB; VKORC1; PPP5C; FBXO2; PSMA3; GRB2; CDC42; Mad2l1; Smad3; Hsd17b7; RRAS2; INSR; DCN; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-AHSG (ARP33815_P050) antibody |
Blocking Peptide |
For anti-AHSG (ARP33815_P050) antibody is Catalog # AAP33815 (Previous Catalog # AAPS19408) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human AHSG |
Uniprot ID |
P02765 |
Protein Name |
Alpha-2-HS-glycoprotein |
Publications |
Gil-Dones, F. et al. Inside human aortic stenosis: a proteomic analysis of plasma. J. Proteomics 75, 1639-53 (2012). 22178735
Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). 24465277 |
Protein Accession # |
NP_001613 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001622 |
Tested Species Reactivity |
Human |
Gene Symbol |
AHSG |
Predicted Species Reactivity |
Human, Rat, Dog, Guinea Pig, Horse |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Dog: 86%; Guinea Pig: 91%; Horse: 79%; Human: 100%; Rat: 100% |
Image 1 | Human Liver
| WB Suggested Anti-AHSG Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:12500 Positive Control: Human Liver |
|