AHSG Antibody - N-terminal region (ARP33815_P050)

Data Sheet
 
Product Number ARP33815_P050
Product Page www.avivasysbio.com/ahsg-antibody-n-terminal-region-arp33815-p050.html
Name AHSG Antibody - N-terminal region (ARP33815_P050)
Protein Size (# AA) 367 amino acids
Molecular Weight 39kDa
NCBI Gene Id 197
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Alpha-2-HS-glycoprotein
Alias Symbols AHS, A2HS, HSGA, APMR1, FETUA
Peptide Sequence Synthetic peptide located within the following region: AQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ix,J.H., et al., (2006) Circulation 113 (14), 1760-1767
Description of Target Alpha2-HS glycoprotein (AHSG), a glycoprotein present in the serum, is synthesized by hepatocytes. The AHSG molecule consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue. However, its exact significance is still obscure.Alpha2-HS glycoprotein (AHSG), a glycoprotein present in the serum, is synthesized by hepatocytes. The AHSG molecule consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue. The protein is commonly present in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix, and it has therefore been postulated that it participates in the development of the tissues. However, its exact significance is still obscure.Alpha2-HS glycoprotein (AHSG), a glycoprotein present in the serum, is synthesized by hepatocytes. The AHSG molecule consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue. The protein is commonly present in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix, and it has therefore been postulated that it participates in the development of the tissues. However, its exact significance is still obscure. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Interactions SUMO1; UBC; NEDD8; ATF2; ALB; VKORC1; PPP5C; FBXO2; PSMA3; GRB2; CDC42; Mad2l1; Smad3; Hsd17b7; RRAS2; INSR; DCN;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-AHSG (ARP33815_P050) antibody
Blocking Peptide For anti-AHSG (ARP33815_P050) antibody is Catalog # AAP33815 (Previous Catalog # AAPS19408)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human AHSG
Uniprot ID P02765
Protein Name Alpha-2-HS-glycoprotein
Publications

Gil-Dones, F. et al. Inside human aortic stenosis: a proteomic analysis of plasma. J. Proteomics 75, 1639-53 (2012). 22178735

Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). 24465277

Protein Accession # NP_001613
Purification Affinity Purified
Nucleotide Accession # NM_001622
Tested Species Reactivity Human
Gene Symbol AHSG
Predicted Species Reactivity Human, Rat, Dog, Guinea Pig, Horse
Application WB
Predicted Homology Based on Immunogen Sequence Dog: 86%; Guinea Pig: 91%; Horse: 79%; Human: 100%; Rat: 100%
Image 1
Human Liver
WB Suggested Anti-AHSG Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Human Liver
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com