Product Number |
ARP33810_P050 |
Product Page |
www.avivasysbio.com/a1bg-antibody-n-terminal-region-arp33810-p050.html |
Name |
A1BG Antibody - N-terminal region (ARP33810_P050) |
Protein Size (# AA) |
495 amino acids |
Molecular Weight |
54kDa |
NCBI Gene Id |
1 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
alpha-1-B glycoprotein |
Alias Symbols |
A1B, ABG, GAB, HYST2477 |
Peptide Sequence |
Synthetic peptide located within the following region: MAPVSWITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVPEAQEDVEATF |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Udby,L., et al., (2004) Biochemistry 43 (40), 12877-12886 |
Description of Target |
A1BG is a plasma glycoprotein of unknown function. It shows sequence similarity to the variable regions of some immunoglobulin supergene family member proteins. |
Protein Interactions |
SETD7; PRDX4; ABCC6; TK1; SNCA; SMN1; GRB7; CDKN1A; ANXA7; CRISP3; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-A1BG (ARP33810_P050) antibody |
Blocking Peptide |
For anti-A1BG (ARP33810_P050) antibody is Catalog # AAP33810 (Previous Catalog # AAPP04876) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human A1BG |
Uniprot ID |
P04217 |
Protein Name |
Alpha-1B-glycoprotein |
Publications |
Abdi, F. et al. Detection of biomarkers with a multiplex quantitative proteomic platform in cerebrospinal fluid of patients with neurodegenerative disorders. J. Alzheimers. Dis. 9, 293-348 (2006). 16914840
Abdul-Rahman, P. S., Lim, B.-K. & Hashim, O. H. Expression of high-abundance proteins in sera of patients with endometrial and cervical cancers: analysis using 2-DE with silver staining and lectin detection methods. Electrophoresis 28, 1989-96 (2007). 17503403
Kim, Y.-S. et al. Apolipoprotein A-IV as a novel gene associated with polycystic ovary syndrome. Int. J. Mol. Med. 31, 707-16 (2013). 23338533
Surin, B. et al. LG3 fragment of endorepellin is a possible biomarker of severity in IgA nephropathy. Proteomics 13, 142-52 (2013). 23161552
Tian, M. et al. Proteomic analysis identifies MMP-9, DJ-1 and A1BG as overexpressed proteins in pancreatic juice from pancreatic ductal adenocarcinoma patients. BMC Cancer 8, 241 (2008). 18706098 |
Protein Accession # |
NP_570602 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_130786 |
Tested Species Reactivity |
Human |
Gene Symbol |
A1BG |
Predicted Species Reactivity |
Human |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100% |
Image 1 | Human Fetal Liver
| WB Suggested Anti-A1BG Antibody Titration: 0.1ug/ml Positive Control: Fetal Liver |
|
Image 2 | Human
| WB Suggested Anti-A1BG Antibody Titration: 5 ug/ml Positive Control: human liver, human serum, human plasma |
|
Image 3 | Human HepG2
| WB Suggested Anti-A1BG AntibodyTitration: 1.25 ug/mlPositive Control: HepG2 Whole CellA1BG is supported by BioGPS gene expression data to be expressed in HepG2 |
|
Image 4 | Human HepG2
| Host: Rabbit Target Name: EGFL8 Sample Type: HepG2 Antibody Dilution: 1.0ug/mlA1BG is supported by BioGPS gene expression data to be expressed in HepG2 |
|
Image 5 | Human Jurkat
| Host: Rabbit Target Name: A1BG Sample Type: Jurkat Antibody Dilution: 1.0ug/mlA1BG is supported by BioGPS gene expression data to be expressed in Jurkat |
|
Image 6 | Human 721_B
| Host: Rabbit Target Name: A1BG Sample Type: 721_B Antibody Dilution: 1.0ug/mlA1BG s supported by BioGPS gene expression data to be expressed in 721_B |
|