SLC17A2 Antibody - middle region (ARP33806_P050)

• Product Number: ARP33806_P050
• Name: SLC17A2 Antibody - middle region (ARP33806_P050)
• Protein Size (# AA): 436 amino acids
• Molecular Weight: 48kDa
• NCBI Gene Id: 10246
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Solute carrier family 17 (sodium phosphate), member 2
• Alias Symbols: NPT3
• Peptide Sequence: Synthetic peptide located within the following region: VIYDDPMHHPCISVREKEHILSSLAQQPSSPGRAVPIKAMVTCLPLWAIF
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Ruddy,D.A., et al., (1997) Genome Res. 7 (5), 441-456
• Description of Target: SLC17A2 is a member of the solute carrier family.
• Protein Interactions: UBC;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-SLC17A2 (ARP33806_P050) antibody is Catalog # AAP33806 (Previous Catalog # AAPP04872)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC17A2
• Uniprot ID: O00624
• Protein Name: Sodium-dependent phosphate transport protein 3
• Protein Accession #: NP_005826
• Purification: Affinity Purified
• Nucleotide Accession #: NM_005835
• Tested Species Reactivity: Human
• Gene Symbol: SLC17A2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Guinea Pig, Horse
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 85%; Guinea Pig: 91%; Horse: 77%; Human: 100%; Mouse: 85%; Rat: 92%
• Image 1: Human Jurkat
  
  WB Suggested Anti-SLC17A2 Antibody Titration: 0.2-1 ug/ml
  Positive Control: Jurkat cell lysate
• Image 2: Human kidney
  
  Human kidney
• Image 3: Human Liver, Human Lung
  
  Host: Rabbit
  Target: SLC17A2
  Positive control (+): Human Liver (LI)
  Negative control (-): Human Lung (LU)
  Antibody concentration: 2ug/ml