ASGR1 Antibody - middle region (ARP33805_T100)

• Product Number: ARP33805_T100
• Name: ASGR1 Antibody - middle region (ARP33805_T100)
• Protein Size (# AA): 291 amino acids
• Molecular Weight: 33 kDa
• NCBI Gene Id: 432
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Asialoglycoprotein receptor 1
• Alias Symbols: HL-1, ASGPR, ASGPR1, CLEC4H1
• Peptide Sequence: Synthetic peptide located within the following region: RKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQMAALQGNGS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Saunier,B., et al., (2003) J. Virol. 77(1), 546-59
• Description of Target: ASGR1 encodes for a cell surface receptor binds to galactose-terminated glycoproteins. It transports these glycoproteins via a series of membrane vesicles and tubules to an acidic-sorting organelle where the receptor and ligand dissociates. Then the receptor is recycled back to the cell surface.
• Protein Interactions: CERS2; HIVEP1; SYVN1; VKORC1; FBXO6; EDEM1; HSPA5; CANX; APP; CLEC4G; NLK; RBBP6; HSP90B1; TG; HSP90AA1; DHFR; ASGR2; ITGA1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation: Relative Expression (Western Blot)
  
• Blocking Peptide: For anti-ASGR1 (ARP33805_T100) antibody is Catalog # AAP33805
• Immunogen: The immunogen is a synthetic peptide directed towards the middlel region of human ASGR1
• Uniprot ID: P07306
• Protein Name: ASGR1 protein EMBL CAG46849.1
• Sample Type Confirmation:

  ASGR1 is supported by BioGPS gene expression data to be expressed in HepG2

• Protein Accession #: NP_001662
• Purification: Protein A purified
• Nucleotide Accession #: NM_001671
• Tested Species Reactivity: Human
• Gene Symbol: ASGR1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Guinea Pig, Horse, Pig, Yeast
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 85%; Guinea Pig: 92%; Horse: 86%; Human: 100%; Mouse: 91%; Pig: 93%; Rat: 92%; Yeast: 75%
• Image 1: Human Stomach Tumor
  
  Host: Rabbit
  Target Name: ASGR1
  Sample Tissue: Human Stomach Tumor
  Antibody Dilution: 1.0ug/ml
• Image 2: Human Ovary Tumor
  
  Host: Rabbit
  Target Name: ASGR1
  Sample Tissue: Human Ovary Tumor
  Antibody Dilution: 1ug/ml
• Image 3: Western Blot
  
  25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Protein may be glycosylated and/or lipidated.