AFM Antibody - middle region (ARP33804_P050)

• Product Number: ARP33804_P050
• Name: AFM Antibody - middle region (ARP33804_P050)
• Protein Size (# AA): 599 amino acids
• Molecular Weight: 69kDa
• NCBI Gene Id: 173
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Afamin
• Alias Symbols: ALF, ALB2, ALBA
• Peptide Sequence: Synthetic peptide located within the following region: GQCIINSNKDDRPKDLSLREGKFTDSENVCQERDADPDTFFAKFTFEYSR
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Jerkovic,L., et al., (2005) J. Proteome Res. 4 (3), 889-899
• Description of Target: AFM is a member of the albumin gene family, which is comprised of four genes that localize to chromosome 4 in a tandem arrangement. These four genes encode structurally-related serum transport proteins that are known to be evolutionarily related. AFM is regulated developmentally, expressed in the liver and secreted into the bloodstream.This gene is a member of the albumin gene family, which is comprised of four genes that localize to chromosome 4 in a tandem arrangement. These four genes encode structurally-related serum transport proteins that are known to be evolutionarily related. The protein encoded by this gene is regulated developmentally, expressed in the liver and secreted into the bloodstream.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-AFM (ARP33804_P050) antibody is Catalog # AAP33804 (Previous Catalog # AAPP04870)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human AFM
• Uniprot ID: P43652
• Protein Name: Afamin
• Publications:

  Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). 24465277

  Penno, M. A. S. et al. 2D-DIGE analysis of sera from transgenic mouse models reveals novel candidate protein biomarkers for human gastric cancer. J. Proteomics 77, 40-58 (2012). 22789672

• Protein Accession #: NP_001124
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001133
• Tested Species Reactivity: Human
• Gene Symbol: AFM
• Predicted Species Reactivity: Human, Guinea Pig
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Guinea Pig: 79%; Human: 100%
• Image 1: Human HepG2
  
  WB Suggested Anti-AFM Antibody Titration: 0.2-1 ug/ml
  Positive Control: HepG2 cell lysate
• Image 2: Human Placenta, Human Liver
  
  Host: Rabbit
  Target: AFM
  Positive control (+): Human Placenta (PL)
  Negative control (-): Human Liver (LI)
  Antibody concentration: 1ug/ml