SLC4A1 Antibody - N-terminal region (ARP33801_P050)

• Product Number: ARP33801_P050
• Name: SLC4A1 Antibody - N-terminal region (ARP33801_P050)
• Protein Size (# AA): 911 amino acids
• Molecular Weight: 102 kDa
• NCBI Gene Id: 6521
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: solute carrier family 4 member 1 (Diego blood group)
• Alias Symbols: DI, FR, SW, WD, WR, AE1, CHC, SAO, WD1, BND3, EPB3, SPH4, CD233, EMPB3, RTA1A
• Peptide Sequence: Synthetic peptide located within the following region: PSQPLLPQHSSLETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGR
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Kittanakom,S., et al., (2004) J. Biol. Chem. 279 (39), 40960-40971
• Description of Target: The protein encoded by this gene is part of the anion exchanger (AE) family and is expressed in the erythrocyte plasma membrane, where it functions as a chloride/bicarbonate exchanger involved in carbon dioxide transport from tissues to lungs. The protein comprises two domains that are structurally and functionally distinct. The N-terminal 40kDa domain is located in the cytoplasm and acts as an attachment site for the red cell skeleton by binding ankyrin. The glycosylated C-terminal membrane-associated domain contains 12-14 membrane spanning segments and carries out the stilbene disulphonate-sensitive exchange transport of anions. The cytoplasmic tail at the extreme C-terminus of the membrane domain binds carbonic anhydrase II. The encoded protein associates with the red cell membrane protein glycophorin A and this association promotes the correct folding and translocation of the exchanger. This protein is predominantly dimeric but forms tetramers in the presence of ankyrin. Many mutations in this gene are known in man, and these mutations can lead to two types of disease: destabilization of red cell membrane leading to hereditary spherocytosis, and defective kidney acid secretion leading to distal renal tubular acidosis. Other mutations that do not give rise to disease result in novel blood group antigens, which form the Diego blood group system. Southeast Asian ovalocytosis (SAO, Melanesian ovalocytosis) results from the heterozygous presence of a deletion in the encoded protein and is common in areas where Plasmodium falciparum malaria is endemic. One null mutation in this gene is known, resulting in very severe anemia and nephrocalcinosis.
• Protein Interactions: UBC; PIN1; HECW2; CBX8; CBX5; MDC1; TRPM8; TXLNG; SBDS; TTC4; SUMO2; Mad2l2;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-SLC4A1 (ARP33801_P050) antibody is Catalog # AAP33801 (Previous Catalog # AAPP04867)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC4A1
• Uniprot ID: P02730
• Protein Name: Band 3 anion transport protein
• Protein Accession #: NP_000333
• Purification: Affinity Purified
• Nucleotide Accession #: NM_000342
• Tested Species Reactivity: Human
• Gene Symbol: SLC4A1
• Predicted Species Reactivity: Human, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Horse: 85%; Human: 100%; Rabbit: 85%
• Image 1:
  
  25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment. The protein may be modified by phosphorylation.