| Product Number |
ARP33799_P050 |
| Product Page |
www.avivasysbio.com/epb42-antibody-middle-region-arp33799-p050.html |
| Name |
EPB42 Antibody - middle region (ARP33799_P050) |
| Protein Size (# AA) |
721 amino acids |
| Molecular Weight |
80kDa |
| NCBI Gene Id |
2038 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Erythrocyte membrane protein band 4.2 |
| Alias Symbols |
PA, SPH5 |
| Peptide Sequence |
Synthetic peptide located within the following region: ISTKGVGSDRCEDITQNYKYPEGSLQEKEVLERVEKEKMEREKDNGIRPP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Dahl,K.N., et al., (2004) Blood 103 (3), 1131-1136 |
| Description of Target |
Erythrocyte membrane protein band 4.2 is an ATP-binding protein which may regulate the association of protein 3 with ankyrin. It probably has a role in erythrocyte shape and mechanical property regulation. Mutations in the EPB42 gene are associated with recessive spherocytic elliptocytosis and recessively transmitted hereditary hemolytic anemia. |
| Protein Interactions |
MAPK14; SPINK7; BLOC1S4; STX12; CD47; SLC4A2; KRAS; ANK1; SPTAN1; EPB41; DMTN; SLC4A1; ANK2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-EPB42 (ARP33799_P050) antibody |
| Blocking Peptide |
For anti-EPB42 (ARP33799_P050) antibody is Catalog # AAP33799 (Previous Catalog # AAPP04865) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human EPB42 |
| Uniprot ID |
P16452-2 |
| Protein Name |
Erythrocyte membrane protein band 4.2 |
| Protein Accession # |
NP_000110 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_000119 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
EPB42 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 85%; Dog: 92%; Guinea Pig: 77%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 100%; Zebrafish: 75% |
| Image 1 | Human Liver
 | WB Suggested Anti-EPB42 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Liver |
|
|
