PARP11 Antibody - N-terminal region (ARP33768_P050)

Data Sheet
 
Product Number ARP33768_P050
Product Page www.avivasysbio.com/parp11-antibody-n-terminal-region-arp33768-p050.html
Name PARP11 Antibody - N-terminal region (ARP33768_P050)
Protein Size (# AA) 331 amino acids
Molecular Weight 39kDa
NCBI Gene Id 57097
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name poly(ADP-ribose) polymerase family member 11
Alias Symbols ARTD11, MIB006, C12orf6
Peptide Sequence Synthetic peptide located within the following region: SAFSYICENEAIPMPPHWENVNTQVPYQLIPLHNQTHEYNEVANLFGKTM
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Puente,X.S., et al., (2003) Nat. Rev. Genet. 4 (7), 544-558
Description of Target The PARP11 gene is part of the poly (ADP-ribose) polymerase family.
Protein Interactions UBC; LMO4; LMO2; APP; NEDD4L; KIF3A; VHL; RAD21; IFT20; KIFAP3; MAP3K10; RAB4A; MAP3K11; RAB5A;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PARP11 (ARP33768_P050) antibody
Blocking Peptide For anti-PARP11 (ARP33768_P050) antibody is Catalog # AAP33768 (Previous Catalog # AAPP04834)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PARP11
Uniprot ID Q9NR21
Protein Name Poly [ADP-ribose] polymerase 11
Sample Type Confirmation

PARP11 is supported by RNA seq expression data to be expressed in HepG2

Protein Accession # NP_065100
Purification Affinity Purified
Nucleotide Accession # NM_020367
Tested Species Reactivity Human
Gene Symbol KIF3B
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 91%; Pig: 100%; Rabbit: 93%; Rat: 79%
Image 1
Human Lung
WB Suggested Anti-PARP11 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human lung tissue lysatePARP11 is supported by BioGPS gene expression data to be expressed in HepG2
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com