| Product Number |
ARP33766_T100 |
| Product Page |
www.avivasysbio.com/parp6-antibody-n-terminal-region-arp33766-t100.html |
| Name |
PARP6 Antibody - N-terminal region (ARP33766_T100) |
| Protein Size (# AA) |
519 amino acids |
| Molecular Weight |
59kDa |
| NCBI Gene Id |
56965 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Poly (ADP-ribose) polymerase family, member 6 |
| Alias Symbols |
ARTD17, pART17, PARP-6-C, PARP-6-B1 |
| Peptide Sequence |
Synthetic peptide located within the following region: HINISFLDEEVSTAWKVLRTEPIVLRLRFSLSQYLDGPEPSIEVFQPSNK |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Ota,T., et al., (2004) Nat. Genet. 36 (1), 40-45 |
| Description of Target |
Poly(ADP-ribose) polymerases (PARPs) constitute a large family of 18 proteins, encoded by different genes and displaying a conserved catalytic domain. They are involved in DNA-damage-dependent post-translational modification of histones and other nuclear proteins that contributes to the survival of injured proliferating cells. |
| Protein Interactions |
UBA5; ANKMY2; NSFL1C; RPRD1A; ARIH2; PLIN3; PLAA; SURF2; HK1; CBS; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PARP6 (ARP33766_T100) antibody |
| Blocking Peptide |
For anti-PARP6 (ARP33766_T100) antibody is Catalog # AAP33766 (Previous Catalog # AAPP04832) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human PARP6 |
| Uniprot ID |
Q9HAF3 |
| Protein Name |
Poly [ADP-ribose] polymerase 6 |
| Sample Type Confirmation |
PARP6 is supported by BioGPS gene expression data to be expressed in Daudi |
| Protein Accession # |
NP_064599 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_020214 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PARP6 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
| Image 1 | Human Daudi
 | WB Suggested Anti-PARP6 Antibody Titration: 1.25ug/ml
Positive Control: Daudi cell lysatePARP6 is supported by BioGPS gene expression data to be expressed in Daudi |
|
