PARP2 Antibody - middle region (ARP33758_P050)

• Product Number: ARP33758_P050
• Name: PARP2 Antibody - middle region (ARP33758_P050)
• Protein Size (# AA): 534 amino acids
• Molecular Weight: 66 kDa
• NCBI Gene Id: 10038
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: poly(ADP-ribose) polymerase 2
• Alias Symbols: ARTD2, ADPRT2, PARP-2, ADPRTL2, ADPRTL3, pADPRT-2
• Peptide Sequence: Synthetic peptide located within the following region: LLDLFEVEKDGEKEAFREDLHNRMLLWHGSRMSNWVGILSHGLRIAHPEA
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Malanga,M. et al., (2004) J. Biol. Chem. 279 (7), 5244-5248
• Description of Target: This gene encodes poly(ADP-ribosyl)transferase-like 2 protein, which contains a catalytic domain and is capable of catalyzing a poly(ADP-ribosyl)ation reaction. This protein has a catalytic domain which is homologous to that of poly (ADP-ribosyl) transferase, but lacks an N-terminal DNA binding domain which activates the C-terminal catalytic domain of poly (ADP-ribosyl) transferase. The basic residues within the N-terminal region of this protein may bear potential DNA-binding properties, and may be involved in the nuclear and/or nucleolar targeting of the protein. Two alternatively spliced transcript variants encoding distinct isoforms have been found.
• Protein Interactions: UHRF1; Npm1; TFAP4; UBC; RNF146; H3F3A; CBX5; TRIM28; CHD1L; TNP2; HSPA2; BUB3; CASP8; XRCC1; PARP1; CENPB; CENPA;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-PARP2 (ARP33758_P050) antibody is Catalog # AAP33758 (Previous Catalog # AAPP04824)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PARP2
• Uniprot ID: Q9UGN5
• Protein Name: poly [ADP-ribose] polymerase 2
• Sample Type Confirmation:

  PARP2 is strongly supported by BioGPS gene expression data to be expressed in Raji

• Protein Accession #: NP_005475
• Purification: Affinity Purified
• Nucleotide Accession #: NM_005484
• Tested Species Reactivity: Human, Rat
• Gene Symbol: PARP2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: IF, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 86%; Guinea Pig: 92%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 92%
• Image 1: Rat thyrocytes-FRTL-5
  
  Sample Type:
  Rat thyrocytes-FRTL-5
  Primary Antibody Dilution:
  1:100
  Secondary Antibody:
  Anti-rabbit-Texas Red
  Secondary Antibody Dilution:
  1:100
  Color/Signal Descriptions:
  Red: PARP2 Blue: DAPI
  Gene Name:
  PARP2
  Submitted by:
  Syed A Morshed, Mount Sinai School of Medicine and James J Peters VA Medical Center
• Image 2: Human Jurkat Whole Cell
  
  Host: Rabbit
  Target Name: PARP2
  Sample Tissue: Human Jurkat Whole Cell
  Antibody Dilution: 3ug/ml