Product Number |
ARP33750_T100 |
Product Page |
www.avivasysbio.com/foxp2-antibody-n-terminal-region-arp33750-t100.html |
Name |
FOXP2 Antibody - N-terminal region (ARP33750_T100) |
Protein Size (# AA) |
715 amino acids |
Molecular Weight |
80kDa |
NCBI Gene Id |
93986 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Forkhead box P2 |
Alias Symbols |
SPCH1, CAGH44, TNRC10 |
Peptide Sequence |
Synthetic peptide located within the following region: SGLKSPKSSDKQRPLQVPVSVAMMTPQVITPQQMQQILQQQVLSPQQLQA |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Sanjuan,J., (2006) Psychiatr. Genet. 16 (2), 67-72 |
Description of Target |
FOXP2 is an evolutionarily conserved transcription factor expressed in fetal and adult brain. This transcription factor is a member of the forkhead/winged-helix (FOX) family of transcription factors, and contains a FOX DNA-binding domain and a large polyglutamine tract. Members of the FOX family of transcription factors are regulators of embryogenesis. The product of this gene is thought to be required for proper development of speech and language regions of the brain during embryogenesis. Although a point mutation in this gene has been associated with the KE pedigree segregating developmental verbal dyspraxia, no association between mutations in this gene and another speech disorder, autism, has been found. Four alternative transcripts encoding three different isoforms have been identified.This gene encodes an evolutionarily conserved transcription factor expressed in fetal and adult brain. This transcription factor is a member of the forkhead/winged-helix (FOX) family of transcription factors, and contains a FOX DNA-binding domain and a large polyglutamine tract. Members of the FOX family of transcription factors are regulators of embryogenesis. The product of this gene is thought to be required for proper development of speech and language regions of the brain during embryogenesis. Although a point mutation in this gene has been associated with the KE pedigree segregating developmental verbal dyspraxia, no association between mutations in this gene and another speech disorder, autism, has been found. Four alternative transcripts encoding three different isoforms have been identified. |
Protein Interactions |
FAM124A; TSACC; RPIA; SP4; SDCBP; PIN1; CTBP2; CTBP1; CCNC; AES; MAPK3; HSP90AA1; GATAD2B; FOXP1; FOXP4; FOXP2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-FOXP2 (ARP33750_T100) antibody |
Blocking Peptide |
For anti-FOXP2 (ARP33750_T100) antibody is Catalog # AAPP23829 |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human FOXP2 |
Uniprot ID |
O15409 |
Protein Name |
Forkhead box protein P2 |
Protein Accession # |
NP_055306 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_014491 |
Tested Species Reactivity |
Human |
Gene Symbol |
FOXP2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Goat, Horse, Pig, Rabbit, Zebrafish |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Dog: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 82% |
Image 1 | Human kidney
| Rabbit Anti-FOXP2 Antibody Catalog Number: ARP33750 Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X |
|
Image 2 | Human HepG2
| WB Suggested Anti-FOXP2 Antibody Titration: 0.5ug/ml Positive Control: HepG2 cell lysate |
|
Image 3 | Human HepG2
| WB Suggested Antibody Titration: 0.2-1 ug/ml Positive Control: HepG2 |
|