FOXP2 Antibody - N-terminal region (ARP33750_T100)

Data Sheet
 
Product Number ARP33750_T100
Product Page www.avivasysbio.com/foxp2-antibody-n-terminal-region-arp33750-t100.html
Name FOXP2 Antibody - N-terminal region (ARP33750_T100)
Protein Size (# AA) 715 amino acids
Molecular Weight 80kDa
NCBI Gene Id 93986
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Forkhead box P2
Alias Symbols SPCH1, CAGH44, TNRC10
Peptide Sequence Synthetic peptide located within the following region: SGLKSPKSSDKQRPLQVPVSVAMMTPQVITPQQMQQILQQQVLSPQQLQA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Sanjuan,J., (2006) Psychiatr. Genet. 16 (2), 67-72
Description of Target FOXP2 is an evolutionarily conserved transcription factor expressed in fetal and adult brain. This transcription factor is a member of the forkhead/winged-helix (FOX) family of transcription factors, and contains a FOX DNA-binding domain and a large polyglutamine tract. Members of the FOX family of transcription factors are regulators of embryogenesis. The product of this gene is thought to be required for proper development of speech and language regions of the brain during embryogenesis. Although a point mutation in this gene has been associated with the KE pedigree segregating developmental verbal dyspraxia, no association between mutations in this gene and another speech disorder, autism, has been found. Four alternative transcripts encoding three different isoforms have been identified.This gene encodes an evolutionarily conserved transcription factor expressed in fetal and adult brain. This transcription factor is a member of the forkhead/winged-helix (FOX) family of transcription factors, and contains a FOX DNA-binding domain and a large polyglutamine tract. Members of the FOX family of transcription factors are regulators of embryogenesis. The product of this gene is thought to be required for proper development of speech and language regions of the brain during embryogenesis. Although a point mutation in this gene has been associated with the KE pedigree segregating developmental verbal dyspraxia, no association between mutations in this gene and another speech disorder, autism, has been found. Four alternative transcripts encoding three different isoforms have been identified.
Protein Interactions FAM124A; TSACC; RPIA; SP4; SDCBP; PIN1; CTBP2; CTBP1; CCNC; AES; MAPK3; HSP90AA1; GATAD2B; FOXP1; FOXP4; FOXP2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-FOXP2 (ARP33750_T100) antibody
Blocking Peptide For anti-FOXP2 (ARP33750_T100) antibody is Catalog # AAPP23829
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human FOXP2
Uniprot ID O15409
Protein Name Forkhead box protein P2
Protein Accession # NP_055306
Purification Protein A purified
Nucleotide Accession # NM_014491
Tested Species Reactivity Human
Gene Symbol FOXP2
Predicted Species Reactivity Human, Mouse, Rat, Dog, Goat, Horse, Pig, Rabbit, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Dog: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 82%
Image 1
Human kidney
Rabbit Anti-FOXP2 Antibody Catalog Number: ARP33750 Paraffin Embedded Tissue: Human Kidney Cellular Data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X
Image 2
Human HepG2
WB Suggested Anti-FOXP2 Antibody Titration: 0.5ug/ml
Positive Control: HepG2 cell lysate
Image 3
Human HepG2
WB Suggested Antibody
Titration: 0.2-1 ug/ml
Positive Control: HepG2
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com