| Product Number |
ARP33747_P050 |
| Product Page |
www.avivasysbio.com/foxq1-antibody-n-terminal-region-arp33747-p050.html |
| Name |
FOXQ1 Antibody - N-terminal region (ARP33747_P050) |
| Protein Size (# AA) |
403 amino acids |
| Molecular Weight |
41kDa |
| NCBI Gene Id |
94234 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Forkhead box Q1 |
| Alias Symbols |
HFH1 |
| Peptide Sequence |
Synthetic peptide located within the following region: MKLEVFVPRAAHGDKQGSDLEGAGGSDAPSPLSAAGDDSLGSDGDCAANS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Samatar,A.A., (2002) J. Biol. Chem. 277 (31), 28118-28126 |
| Description of Target |
FOXQ1 contains 1 fork-head DNA-binding domain. FOXQ1 mediates the interaction of Akt/protein kinase B with TGFb2. Foxq1 regulates differentiation of hair in satin mice. |
| Protein Interactions |
Dlg4; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-FOXQ1 (ARP33747_P050) antibody |
| Blocking Peptide |
For anti-FOXQ1 (ARP33747_P050) antibody is Catalog # AAP33747 (Previous Catalog # AAPP23827) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human FOXQ1 |
| Uniprot ID |
Q9C009 |
| Protein Name |
Forkhead box protein Q1 |
| Protein Accession # |
NP_150285 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_033260 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
FOXQ1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Pig |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100%; Mouse: 85%; Pig: 86%; Rat: 85% |
| Image 1 | Human HepG2
 | WB Suggested Anti-FOXQ1 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate |
| | Image 2 | Human Lung
 | Human Lung |
|
|
