Product Number |
ARP33739_P050 |
Product Page |
www.avivasysbio.com/tbx4-antibody-middle-region-arp33739-p050.html |
Name |
TBX4 Antibody - middle region (ARP33739_P050) |
Protein Size (# AA) |
545 amino acids |
Molecular Weight |
60kDa |
NCBI Gene Id |
9496 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
T-box 4 |
Alias Symbols |
SPS, ICPPS, PAPPAS |
Peptide Sequence |
Synthetic peptide located within the following region: LRVARLQSKEYPVISKSIMRQRLISPQLSATPDVGPLLGTHQALQHYQHE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Bongers,E.M., et al., (2004) Am. J. Hum. Genet. 74 (6), 1239-1248 |
Description of Target |
The TBX4 gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene is the human homolog of mouse Tbx4, which is closely linked to Tbx2 on mouse chromosome 11. Similarly this gene, like TBX2, maps to human chromosome 17. Expression studies in mouse and chicken show that Tbx4 is expressed in developing hindlimb, but not in forelimb buds, suggesting a role for this gene in regulating limb development and specification of limb identity. |
Protein Interactions |
FAM46A; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-TBX4 (ARP33739_P050) antibody |
Blocking Peptide |
For anti-TBX4 (ARP33739_P050) antibody is Catalog # AAP33739 (Previous Catalog # AAPP04805) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human TBX4 |
Uniprot ID |
P57082 |
Protein Name |
T-box transcription factor TBX4 |
Protein Accession # |
NP_060958 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_018488 |
Tested Species Reactivity |
Human |
Gene Symbol |
TBX4 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 79% |
Image 1 | Human HepG2
| WB Suggested Anti-TBX4 Antibody Titration: 0.2-1 ug/ml Positive Control: HepG2 cell lysate |
|
Image 2 | Human lung, MCF7
| Host: Rabbit Target: TBX4 Positive control (+): Human lung (LU) Negative control (-): MCF7 (N10) Antibody concentration: 1ug/ml |
|
Image 3 | Human 293T Whole Cell
| Host: Rabbit Target Name: TBX4 Sample Tissue: Human 293T Whole Cell Antibody Dilution: 2ug/ml |
|