TBX4 Antibody - middle region (ARP33739_P050)

Data Sheet
 
Product Number ARP33739_P050
Product Page www.avivasysbio.com/tbx4-antibody-middle-region-arp33739-p050.html
Name TBX4 Antibody - middle region (ARP33739_P050)
Protein Size (# AA) 545 amino acids
Molecular Weight 60kDa
NCBI Gene Id 9496
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name T-box 4
Alias Symbols SPS, ICPPS, PAPPAS
Peptide Sequence Synthetic peptide located within the following region: LRVARLQSKEYPVISKSIMRQRLISPQLSATPDVGPLLGTHQALQHYQHE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Bongers,E.M., et al., (2004) Am. J. Hum. Genet. 74 (6), 1239-1248
Description of Target The TBX4 gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene is the human homolog of mouse Tbx4, which is closely linked to Tbx2 on mouse chromosome 11. Similarly this gene, like TBX2, maps to human chromosome 17. Expression studies in mouse and chicken show that Tbx4 is expressed in developing hindlimb, but not in forelimb buds, suggesting a role for this gene in regulating limb development and specification of limb identity.
Protein Interactions FAM46A;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TBX4 (ARP33739_P050) antibody
Blocking Peptide For anti-TBX4 (ARP33739_P050) antibody is Catalog # AAP33739 (Previous Catalog # AAPP04805)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human TBX4
Uniprot ID P57082
Protein Name T-box transcription factor TBX4
Protein Accession # NP_060958
Purification Affinity Purified
Nucleotide Accession # NM_018488
Tested Species Reactivity Human
Gene Symbol TBX4
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 79%
Image 1
Human HepG2
WB Suggested Anti-TBX4 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
Image 2
Human lung, MCF7
Host: Rabbit
Target: TBX4
Positive control (+): Human lung (LU)
Negative control (-): MCF7 (N10)
Antibody concentration: 1ug/ml
Image 3
Human 293T Whole Cell
Host: Rabbit
Target Name: TBX4
Sample Tissue: Human 293T Whole Cell
Antibody Dilution: 2ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com