| Product Number |
ARP33730_P050 |
| Product Page |
http://www.avivasysbio.com/anti-clock-antibody-n-terminal-region-arp33730-p050.html |
| Product Name |
CLOCK antibody - N-terminal region (ARP33730_P050) |
| Size |
50ug |
| Gene Symbol |
CLOCK |
| Alias Symbols |
KAT13D; KIAA0334; bHLHe8 |
| Nucleotide Accession# |
NM_004898 |
| Protein Accession# |
NP_004889 |
| Swissprot Id |
O15516 |
| Protein Size (# AA) |
846 amino acids |
| Molecular Weight |
95kDa |
| Product Format |
Lyophilized powder |
| NCBI Gene Id |
9575 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Purification |
Affinity Purified |
| Official Gene Full Name |
Clock homolog (mouse) |
| Description |
This is a rabbit polyclonal antibody against CLOCK. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com). |
| Peptide Sequence |
Synthetic peptide located within the following region: LFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFN |
| Key Reference |
Marino,J.L., (2008) Epidemiology 19 (3), 477-484 |
| Description of Target |
CLOCK is a protein that belongs to the basic helix-loop-helix (bHLH) family of transcription factors. Polymorphisms within the encoded protein have been associated with circadian rhythm sleep disorders. A similar protein in mice is a circadian regulator that acts as a transcription factor and forms a heterodimer with aryl hydrocarbon receptor nuclear translocator-like to activate transcription of mouse period 1.This gene encodes a protein that belongs to the basic helix-loop-helix (bHLH) family of transcription factors. Polymorphisms within the encoded protein have been associated with circadian rhythm sleep disorders. A similar protein in mice is a circadian regulator that acts as a transcription factor and forms a heterodimer with aryl hydrocarbon receptor nuclear translocator-like to activate transcription of mouse period 1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Partner Proteins |
NCOR1, NCOR2, NR1D1, NR1D2, NR2E3, NCOR1 |
| Reconstitution and Storage |
Add 50 μl of distilled water. Final anti-CLOCK antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles. |
| Lead Time |
Domestic: within 24 hours delivery
International: 3-5 business days |
| Blocking Peptide |
For anti-CLOCK antibody is Catalog # AAP33730 (Previous Catalog # AAPP23820) |
| Immunogen |
The immunogen for anti-CLOCK antibody: synthetic peptide directed towards the N terminal of human CLOCK |
| Complete computational species homology data |
CLOCK antibody - N-terminal region (ARP33730_P050) |
| Tissue Tool |
Find tissues and cell lines supported to express CLOCK.  |
| Reviews and Data |
Computational species homology for CLOCK antibody (ARP33730); Product Protocols: CLOCK antibody tested with Human 721_B_Lymphoblast (ARP33730_P050) |
| Homology Short |
African clawed frog, Bovine, Chicken, Guinea pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Dog, Zebrafish |
| Observed Species Reactivity |
Human, Mouse, Rat, African clawed frog, Chicken |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
African clawed frog: 100%; Bovine: 100%; Chicken: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Dog: 93%; Zebrafish: 92% |
| Image 1 | Human 721_B
 | WB Suggested Anti-CLOCK Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 721_B cell lysate |
|
