Product Number |
ARP33727_P050 |
Product Page |
www.avivasysbio.com/nfe2l3-antibody-middle-region-arp33727-p050.html |
Name |
NFE2L3 Antibody - middle region (ARP33727_P050) |
Protein Size (# AA) |
694 amino acids |
Molecular Weight |
76 kDa |
NCBI Gene Id |
9603 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Nuclear factor (erythroid-derived 2)-like 3 |
Alias Symbols |
NRF3 |
Peptide Sequence |
Synthetic peptide located within the following region: NPEQTLPGTNLTGFLSPVDNHMRNLTSQDLLYDLDINIFDEINLMSLATE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Chenais,B., (2005) Mol. Endocrinol. 19 (1), 125-137 |
Description of Target |
NFE2L3 activates erythroid-specific, globin gene expression. |
Protein Interactions |
BACH2; MAFF; CREB3; NFE2L3; NFE2L2; NFE2L1; NFE2; MAFG; UBC; MAFK; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
|
Datasheets/Manuals |
Printable datasheet for anti-NFE2L3 (ARP33727_P050) antibody |
Blocking Peptide |
For anti-NFE2L3 (ARP33727_P050) antibody is Catalog # AAP33727 (Previous Catalog # AAPP23818) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human NFE2L3 |
Uniprot ID |
Q9Y4A8 |
Protein Name |
Nuclear factor erythroid 2-related factor 3 |
Protein Accession # |
NP_004280 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_004289 |
Tested Species Reactivity |
Human |
Gene Symbol |
NFE2L3 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 93%; Guinea Pig: 86%; Human: 100%; Mouse: 93%; Rabbit: 92%; Rat: 93% |
Image 1 | Human HepG2
| WB Suggested Anti-NFE2L3 Antibody Titration: 0.2-1 ug/ml Positive Control: HepG2 cell lysate |
|
|