NFE2L3 Antibody - middle region (ARP33727_P050)

Data Sheet
 
Product Number ARP33727_P050
Product Page www.avivasysbio.com/nfe2l3-antibody-middle-region-arp33727-p050.html
Name NFE2L3 Antibody - middle region (ARP33727_P050)
Protein Size (# AA) 694 amino acids
Molecular Weight 76 kDa
NCBI Gene Id 9603
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Nuclear factor (erythroid-derived 2)-like 3
Alias Symbols NRF3
Peptide Sequence Synthetic peptide located within the following region: NPEQTLPGTNLTGFLSPVDNHMRNLTSQDLLYDLDINIFDEINLMSLATE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Chenais,B., (2005) Mol. Endocrinol. 19 (1), 125-137
Description of Target NFE2L3 activates erythroid-specific, globin gene expression.
Protein Interactions BACH2; MAFF; CREB3; NFE2L3; NFE2L2; NFE2L1; NFE2; MAFG; UBC; MAFK;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
WBY
SPR
YCHAROS
Datasheets/Manuals Printable datasheet for anti-NFE2L3 (ARP33727_P050) antibody
Blocking Peptide For anti-NFE2L3 (ARP33727_P050) antibody is Catalog # AAP33727 (Previous Catalog # AAPP23818)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human NFE2L3
Uniprot ID Q9Y4A8
Protein Name Nuclear factor erythroid 2-related factor 3
Protein Accession # NP_004280
Purification Affinity Purified
Nucleotide Accession # NM_004289
Tested Species Reactivity Human
Gene Symbol NFE2L3
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 93%; Guinea Pig: 86%; Human: 100%; Mouse: 93%; Rabbit: 92%; Rat: 93%
Image 1
Human HepG2
WB Suggested Anti-NFE2L3 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com