| Product Number |
ARP33724_P050 |
| Product Page |
www.avivasysbio.com/rnf14-antibody-n-terminal-region-arp33724-p050.html |
| Name |
Rnf14 Antibody - N-terminal region (ARP33724_P050) |
| Protein Size (# AA) |
479 amino acids |
| Molecular Weight |
52kDa |
| NCBI Gene Id |
619577 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Ring finger protein 14 |
| Alias Symbols |
ARA54 |
| Peptide Sequence |
Synthetic peptide located within the following region: SAEDLEAQEDELLALASIYDGDEFRKAESVQGGETRIYLDLPQNFKIFVS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Rnf14 (ARP33724_P050) antibody |
| Blocking Peptide |
For anti-Rnf14 (ARP33724_P050) antibody is Catalog # AAP33724 (Previous Catalog # AAPP04786) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Rat |
| Uniprot ID |
Q3ZAU6 |
| Protein Name |
RCG49400, isoform CRA_a EMBL EDL76439.1 |
| Protein Accession # |
NP_001030167 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001034995 |
| Tested Species Reactivity |
Rat |
| Gene Symbol |
Rnf14 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100% |
| Image 1 | Rat Liver
 | WB Suggested Anti-Rnf14 Antibody
Titration: 1.0 ug/ml
Positive Control: Rat Liver |
|
|
