MLL4 Antibody - N-terminal region (ARP33704_T100)

• Product Number: ARP33704_T100
• Name: MLL4 Antibody - N-terminal region (ARP33704_T100)
• Protein Size (# AA): 582 amino acids
• Molecular Weight: 64kDa
• NCBI Gene Id: 9757
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Myeloid/lymphoid or mixed-lineage leukemia 4
• Alias Symbols: HRX2, MLL2, MLL4, TRX2, WBP7, DYT28, MLL1B, WBP-7, CXXC10
• Peptide Sequence: Synthetic peptide located within the following region: WAGPRVQRGRGRGRGRGWGPSRGCVPEEESSDGESDEEEFQGFHSDEDVA
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: FitzGerald,K.T., et al., (1999) Genomics 59 (2), 187-192
• Description of Target: MLL4 a protein which contains multiple domains including a CXXC zinc finger, three PHD zinc fingers, two FY-rich domains, and a SET (suppressor of variegation, enhancer of zeste, and trithorax) domain. The SET domain is a conserved C-terminal domain that characterizes proteins of the MLL (mixed-lineage leukemia) family. MLL4 is ubiquitously expressed in adult tissues. It is also amplified in solid tumor cell lines, and may be involved in human cancer
• Protein Interactions: UBC; SMAD3; ZNF512B; ATXN1; HIST2H3C; WDR5; ASH2L; RBBP5; SEPT8; RPP14; NREP; TSC22D1; TK1; SMN1; RAP1B; PIN1; GRB7; RCC1; CDKN1A; ATP1B1; ANXA7; ANXA1; BCL6; WDR82; PAGR1; PAXIP1; NCOA6; SMARCB1; PRPF40A;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-KMT2B (ARP33704_T100) antibody is Catalog # AAP33704 (Previous Catalog # AAPP04766)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MLL4
• Uniprot ID: Q9UMN6-2
• Protein Name: Histone-lysine N-methyltransferase MLL4
• Sample Type Confirmation:

  KMT2B is strongly supported by BioGPS gene expression data to be expressed in HepG2

• Purification: Protein A purified
• Tested Species Reactivity: Human
• Gene Symbol: KMT2B
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 85%; Guinea Pig: 92%; Horse: 83%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 92%; Yeast: 91%
• Image 1: Human HepG2
  
  WB Suggested Anti-MLL4 Antibody Titration: 5ug/ml
  Positive Control: HepG2 cell lysateKMT2B is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells
• Image 2: Human THP-1 Whole Cell
  
  Host: Rabbit
  Target Name: MLL4
  Sample Tissue: Human THP-1 Whole Cell
  Antibody Dilution: 1ug/ml