| Product Number |
ARP33702_P050 |
| Product Page |
www.avivasysbio.com/tox-antibody-n-terminal-region-arp33702-p050.html |
| Name |
TOX Antibody - N-terminal region (ARP33702_P050) |
| Protein Size (# AA) |
526 amino acids |
| Molecular Weight |
58kDa |
| NCBI Gene Id |
9760 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Thymocyte selection-associated high mobility group box |
| Alias Symbols |
TOX1 |
| Peptide Sequence |
Synthetic peptide located within the following region: CLDPYYCNKFDGENMYMSMTEPSQDYVPASQSYPGPSLESEDFNIPPITP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Aliahmad,P., (2004) J. Exp. Med. 199 (8), 1089-1099 |
| Description of Target |
Some high-mobility group (HMG) box proteins (e.g., LEF1) contain a single HMG box motif and bind DNA in a sequence-specific manner, while other members of this family (e.g., HMG1) have multiple HMG boxes and bind DNA in a sequence-independent but structure-dependent manner. All HMG box proteins are able to induce a sharp bend in DNA. TOX contains a single HMG box motif.Some high-mobility group (HMG) box proteins (e.g., LEF1; MIM 153245) contain a single HMG box motif and bind DNA in a sequence-specific manner, while other members of this family (e.g., HMG1; MIM 163905) have multiple HMG boxes and bind DNA in a sequence-independent but structure-dependent manner. All HMG box proteins are able to induce a sharp bend in DNA. TOX contains a single HMG box motif.[supplied by OMIM]. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TOX (ARP33702_P050) antibody |
| Blocking Peptide |
For anti-TOX (ARP33702_P050) antibody is Catalog # AAP33702 (Previous Catalog # AAPS08005) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human TOX |
| Uniprot ID |
O94900 |
| Protein Name |
Thymocyte selection-associated high mobility group box protein TOX |
| Sample Type Confirmation |
TOX is supported by BioGPS gene expression data to be expressed in Jurkat |
| Protein Accession # |
NP_055544 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_014729 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TOX |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 92% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-TOX Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysateTOX is supported by BioGPS gene expression data to be expressed in Jurkat |
|
