TOX antibody - N-terminal region (ARP33702_P050)
Data Sheet
Product Number ARP33702_P050
Product Page
Product Name TOX antibody - N-terminal region (ARP33702_P050)
Gene Symbol TOX
Protein Size (# AA) 526 amino acids
Molecular Weight 58kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Official Gene Full Name Thymocyte selection-associated high mobility group box
Alias Symbols KIAA0808, TOX1
NCBI Gene Id 9760
Host Rabbit
Clonality Polyclonal
Size 100 ul
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Description This is a rabbit polyclonal antibody against TOX. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (
Peptide Sequence Synthetic peptide located within the following region: CLDPYYCNKFDGENMYMSMTEPSQDYVPASQSYPGPSLESEDFNIPPITP
Target Reference Aliahmad,P., (2004) J. Exp. Med. 199 (8), 1089-1099
Description of Target Some high-mobility group (HMG) box proteins (e.g., LEF1) contain a single HMG box motif and bind DNA in a sequence-specific manner, while other members of this family (e.g., HMG1) have multiple HMG boxes and bind DNA in a sequence-independent but structure-dependent manner. All HMG box proteins are able to induce a sharp bend in DNA. TOX contains a single HMG box motif.Some high-mobility group (HMG) box proteins (e.g., LEF1; MIM 153245) contain a single HMG box motif and bind DNA in a sequence-specific manner, while other members of this family (e.g., HMG1; MIM 163905) have multiple HMG boxes and bind DNA in a sequence-independent but structure-dependent manner. All HMG box proteins are able to induce a sharp bend in DNA. TOX contains a single HMG box motif.[supplied by OMIM].
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-TOX (ARP33702_P050) antibody is Catalog # AAP33702 (Previous Catalog # AAPS08005)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human TOX
Complete computational species homology data Anti-TOX (ARP33702_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express TOX.
Swissprot Id O94900
Protein Name Thymocyte selection-associated high mobility group box protein TOX
Sample Type Confirmation

TOX is supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_055544
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express TOX.
Nucleotide Accession # NM_014729
Replacement Item This antibody may replace item sc-374136 from Santa Cruz Biotechnology.
Conjugation Options

ARP33702_P050-FITC Conjugated

ARP33702_P050-HRP Conjugated

ARP33702_P050-Biotin Conjugated

CB Replacement sc-374136; sc-374137; sc-98180
Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 92%
Image 1
Human Jurkat
WB Suggested Anti-TOX Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate

TOX is supported by BioGPS gene expression data to be expressed in Jurkat


AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 |