MAFB Antibody - N-terminal region (ARP33682_T100)

• Product Number: ARP33682_T100
• Name: MAFB Antibody - N-terminal region (ARP33682_T100)
• Protein Size (# AA): 323 amino acids
• Molecular Weight: 36 kDa
• NCBI Gene Id: 9935
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: V-maf musculoaponeurotic fibrosarcoma oncogene homolog B (avian)
• Alias Symbols: KRML, MCTO, DURS3
• Peptide Sequence: Synthetic peptide located within the following region: MAAELSMGPELPTSPLAMEYVNDFDLLKFDVKKEPLGRAERPGRPCTRLQ
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Bakri,Y., (2005) Blood 105 (7), 2707-2716
• Description of Target: MAFB is a basic leucine zipper (bZIP) transcription factor that plays an important role in the regulation of lineage-specific hematopoiesis. The nuclear protein represses ETS1-mediated transcription of erythroid-specific genes in myeloid cells.The protein encoded by this gene is a basic leucine zipper (bZIP) transcription factor that plays an important role in the regulation of lineage-specific hematopoiesis. The encoded nuclear protein represses ETS1-mediated transcription of erythroid-specific genes in myeloid cells. This gene contains no introns.
• Protein Interactions: MAFB; FOSL1; MAF; FOS; BACH1; ATF4; IKBKE; IRF7; IRF3; ZWINT; ZFP64; ZDHHC2; DDB1; JUN; HOXD12;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB
  SPR
  YCHAROS	Y

• Blocking Peptide: For anti-MAFB (ARP33682_T100) antibody is Catalog # AAP33682 (Previous Catalog # AAPS07906)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MAFB
• Uniprot ID: Q9Y5Q3
• Protein Name: Transcription factor MafB
• Protein Accession #: NP_005452
• Purification: Protein A purified
• Nucleotide Accession #: NM_005461
• Tested Species Reactivity: Human
• Gene Symbol: MAFB
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 85%; Guinea Pig: 100%; Horse: 77%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 82%; Zebrafish: 91%
• Image 1: Transient overexpression lysate of MAFB
  
  Host: Rabbit
  Target Name: MAFB
  Sample Type: Lane 1: Non-overexpressed vector control lysate
  Lane 2: Transient overexpression lysate of MAFB
  Antibody Dilution: 1.0ug/ml
• Image 2: Human kidney
  
  Human kidney