| Product Number |
ARP33669_P050 |
| Product Page |
www.avivasysbio.com/zic5-antibody-n-terminal-region-arp33669-p050.html |
| Name |
ZIC5 Antibody - N-terminal region (ARP33669_P050) |
| Protein Size (# AA) |
639 amino acids |
| Molecular Weight |
66kDa |
| NCBI Gene Id |
85416 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zic family member 5 |
| Peptide Sequence |
Synthetic peptide located within the following region: MEPPLSKRNPPALRLADLATAQVQPLQNMTGFPALAGPPAHSQLRAAVAH |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Furushima,K., et al., (2000) Mech. Dev. 98 (1-2), 161-164 |
| Description of Target |
ZIon Channel5 is a member of the ZIon Channel family of C2H2-type zinc finger proteins. Members of this family are important during development, and have been associated X-linked visceral heterotaxy and holoprosencephaly type 5. This gene is closely linked to a gene encoding zinc finger protein of the cerebellum 2, a related family member on chromosome 13. This gene encodes a protein of unknown function. |
| Protein Interactions |
Dlg4; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZIC5 (ARP33669_P050) antibody |
| Blocking Peptide |
For anti-ZIC5 (ARP33669_P050) antibody is Catalog # AAP33669 (Previous Catalog # AAPP04731) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZIC5 |
| Uniprot ID |
Q96T25 |
| Protein Name |
Zinc finger protein ZIC 5 |
| Protein Accession # |
NP_149123 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_033132 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZIC5 |
| Predicted Species Reactivity |
Human, Mouse, Dog, Guinea Pig, Pig, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 100%; Guinea Pig: 86%; Human: 100%; Mouse: 100%; Pig: 92%; Rabbit: 100%; Zebrafish: 79% |
| Image 1 | Human Cerebellum
 | WB Suggested Anti-ZIC5 Antibody Titration: 0.125ug/ml
Positive Control: Human cerebellum |
|
|
