| Product Number |
ARP33665_T100 |
| Product Page |
www.avivasysbio.com/pir-antibody-c-terminal-region-arp33665-t100.html |
| Name |
PIR Antibody - C-terminal region (ARP33665_T100) |
| Protein Size (# AA) |
290 amino acids |
| Molecular Weight |
32kDa |
| NCBI Gene Id |
8544 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Pirin (iron-binding nuclear protein) |
| Peptide Sequence |
Synthetic peptide located within the following region: EPHHTAVLGEGDSVQVENKDPKRSHFVLIAGEPLREPVIQHGPFVMNTNE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Adams,M. (2005) J. Biol. Chem. 280 (31), 28675-28682 |
| Description of Target |
PIR is a member of the cupin superfamily. The protein is an Fe(II)-containing nuclear protein expressed in all tissues of the body and concentrated within dot-like subnuclear structures. Interactions with nuclear factor I/CCAAT box transcription factor as well as B cell lymphoma 3-encoded oncoprotein suggest the protein may act as a transcriptional cofactor and be involved in the regulation of DNA transcription and replication.This gene encodes a member of the cupin superfamily. The encoded protein is an Fe(II)-containing nuclear protein expressed in all tissues of the body and concentrated within dot-like subnuclear structures. Interactions with nuclear factor I/CCAAT box transcription factor as well as B cell lymphoma 3-encoded oncoprotein suggest the encoded protein may act as a transcriptional cofactor and be involved in the regulation of DNA transcription and replication. Alternatively spliced transcript variants have been described. |
| Protein Interactions |
SMAD9; UBL7; SPEN; SUGT1; STAM; PSMB2; PPP2CA; CLNS1A; ARHGDIA; NFIX; NFKBIA; BCL3; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PIR (ARP33665_T100) antibody |
| Blocking Peptide |
For anti-PIR (ARP33665_T100) antibody is Catalog # AAP33665 (Previous Catalog # AAPS07811) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human PIR |
| Uniprot ID |
O00625 |
| Protein Name |
Pirin |
| Protein Accession # |
NP_003653 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_003662 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PIR |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 93%; Guinea Pig: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 79% |
| Image 1 | Human HepG2
 | WB Suggested Anti-PIR Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate |
|
|
