| Product Number |
ARP33647_P050 |
| Product Page |
www.avivasysbio.com/ap3b1-antibody-n-terminal-region-arp33647-p050.html |
| Name |
Ap3b1 Antibody - N-terminal region (ARP33647_P050) |
| Protein Size (# AA) |
1096 amino acids |
| Molecular Weight |
121kDa |
| Subunit |
beta-1 |
| NCBI Gene Id |
309969 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Adaptor-related protein complex 3, beta 1 subunit |
| Description |
|
| Alias Symbols |
Ap3b1 |
| Peptide Sequence |
Synthetic peptide located within the following region: MSSNSFAYNEQSGGGEAAELGQEATSTISSSGAFGLFSSDWKKNEDLKQM |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of Ap3b1 remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Ap3b1 (ARP33647_P050) antibody |
| Blocking Peptide |
For anti-Ap3b1 (ARP33647_P050) antibody is Catalog # AAP33647 (Previous Catalog # AAPP04709) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Rat |
| Uniprot ID |
D4AA25 |
| Protein Name |
Adaptor-related protein complex 3, beta 1 subunit (Predicted), isoform CRA_a EMBL EDM10075.1 |
| Publications |
LRRK2 and RAB7L1 coordinately regulate axonal morphology and lysosome integrity in diverse cellular contexts. Sci Rep. 6, 29945 (2016). 27424887 |
| Protein Accession # |
EDM10075 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001107646 |
| Tested Species Reactivity |
Rat |
| Gene Symbol |
Ap3b1 |
| Predicted Species Reactivity |
Human, Mouse, Cow, Dog, Horse, Pig |
| Application |
WB, IP |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 79%; Horse: 93%; Human: 100%; Mouse: 92%; Pig: 93% |
| Image 1 | Rat Liver
 | WB Suggested Anti-Ap3b1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Rat Liver |
|
| Image 2 | HEK293 Whole Cell Lysate
 | AP3B1 was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with ARP33647_P050 with 1:200 dilution. Western blot was performed using ARP33647_P050 at 1/1000 dilution.
Lane 1: Control IP in HEK293 Whole Cell Lysate.
Lane 2: AP3B1 IP with ARP33647_P050 in HEK293 Whole Cell Lysate.
Lane 3: Input of HEK293 Whole Cell Lysate. |
|
