Product Number |
ARP33643_T100 |
Product Page |
www.avivasysbio.com/lhx3-antibody-middle-region-arp33643-t100.html |
Name |
LHX3 Antibody - middle region (ARP33643_T100) |
Protein Size (# AA) |
402 amino acids |
Molecular Weight |
44kDa |
NCBI Gene Id |
8022 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
LIM homeobox 3 |
Alias Symbols |
LIM3, CPHD3, M2-LHX3 |
Peptide Sequence |
Synthetic peptide located within the following region: QNRRAKEKRLKKDAGRQRWGQYFRNMKRSRGGSKSDKDSVQEGQDSDAEV |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Dattani,M.T. et al., (2003) Endocrinol Metab 16 (9), 1207-1209 |
Description of Target |
LHX3 encodes a member a large protein family which carry the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein is a transcription factor that is required for pituitary development and motor neuron specification. Mutations in this gene have been associated with a syndrome of combined pituitary hormone deficiency and rigid cervical spine. |
Protein Interactions |
ISL2; IFT172; LDB1; CITED2; ISL1; RLIM; LMX1A; LHX1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-LHX3 (ARP33643_T100) antibody |
Blocking Peptide |
For anti-LHX3 (ARP33643_T100) antibody is Catalog # AAP33643 (Previous Catalog # AAPP04705) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human LHX3 |
Uniprot ID |
Q9UBR4-2 |
Protein Name |
LIM/homeobox protein Lhx3 |
Protein Accession # |
NP_055379 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_014564 |
Tested Species Reactivity |
Human |
Gene Symbol |
LHX3 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 87%; Human: 100%; Mouse: 93%; Rat: 100%; Zebrafish: 80% |
Image 1 | Human Heart
| Human Heart |
| Image 2 | Human Lung
| Human Lung |
| Image 3 | Human Jurkat
| WB Suggested Anti-LHX3 Antibody Titration: 1.25ug/ml Positive Control: Jurkat cell lysate |
|
|